KEGG   Pan paniscus (bonobo): 100994597Help
Entry
100994597         CDS       T02283                                 

Gene name
DYRK1B
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1B
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 589 aa AA seqDB search
MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHIN
EVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKG
SFGQVVKAYDHQTQELVAIKIIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHF
MFRNHLCLVFELLSYNLYDLLRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDL
KPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG
CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERLPGGGWTLRRT
KELRKVRPLPMPLLPPRGPSLTLGALSXGFFRRTADEATNTGPAGSSASTSPAPLDTCPS
SSTASSISSSGGSSGSSSDNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGD
VPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLVGGPADCSPPHP
APAPQHPAASALRTRMTGGRPPLPPPDDPATLGPHLGLRGVPQSTAASS
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcccaccgggccatggtcccttctctggcttcccagggccccaggagcacacg
caggtattgcctgatgtgcggctactgcctcggaggctgcccctggccttccgggatgca
acctcagccccgctgcgtaagctctctgtggacctcatcaagacctacaagcacatcaat
gaggtatactatgcgaagaagaagcggcgggcccagcaggcgccaccccaggattcgagc
aacaagaaggagaagaaggtcctgaaccatggttatgatgacgacaaccatgactacatc
gtgcgcagtggcgagcgctggctggagcgctacgaaattgactcgctcattggcaaaggc
tcctttggccaggtggtgaaagcctatgatcatcagacccaggagcttgtggccatcaag
atcatcaagaacaaaaaggctttcctgaaccaggcccagattgagctgcggctgctagag
ctgatgaaccagcatgacacggagatgaagtactatatagtacacctgaagcggcacttc
atgttccggaaccacctgtgcctggtgtttgagctgctgtcctacaacctgtacgacctc
ctgcgcaacacccacttccgcggcgtctcgctgaacctgacccggaagctggcgcagcag
ctctgcacggcactgctctttctggccacgcctgagctcagcatcattcactgcgacctc
aagcccgaaaacatcttgctgtgcaaccccaaacgcagcgccatcaagattgtggacttc
ggcagctcctgccagcttggccagaggatctaccagtatatccagagccgcttctaccgc
tcacctgaggtgctcctgggcacaccctacgacctggccattgacatgtggtccctgggc
tgcatccttgtggagatgcacaccggagagcccctcttcagtggctccaatgaggtcgac
cagatgaaccgcattgtggaggtgctgggcatcccaccggctgccatgctggaccaggcg
cccaaggctcgcaagtactttgaacggctgcctgggggtggctggaccctacgaaggacg
aaagaactcaggaaggtgcggcccctgcccatgccactcctcccaccccgtggcccctca
ctcacacttggggctctctcnnncggcttcttccgccgcacggccgacgaggccaccaac
acgggcccggcaggcagcagtgcctccacctcgcccgcgcccctcgacacctgcccctct
tccagcaccgccagctccatctccagttctggaggctccagtggctcctccagtgacaac
cggacctaccgctacagcaaccgatattgtgggggccctgggccccctatcacagactgt
gagatgaacagcccccaggtcccaccctcccagccgctgcggccctgggcagggggtgat
gtgccccacaagacacatcaagcccctgcctctgcctcgtcactgcctgggaccggggcc
cagttacccccccagccccgataccttggtcgtcccccatcaccaacctcaccaccaccc
ccggagctgatggatgtgagcctggtgggcggccctgctgactgctccccacctcaccca
gcgcctgccccccagcacccggctgcctcagccctccggactcggatgactggaggtcgt
ccacccctcccgcctcctgatgaccctgccactctggggcctcacctgggcctccgtggt
gtaccccagagcacagcagccagctcgtga

DBGET integrated database retrieval system