KEGG   Pan paniscus (bonobo): 100994899Help
Entry
100994899         CDS       T02283                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Class
Environmental Information Processing; Signal transduction; Ras signaling pathway [PATH:pps04014]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:pps04010]
Cellular Processes; Cell communication; Focal adhesion [PATH:pps04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1273 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERL
TDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLELLFASGQNN
KLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSN
GYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE
ESDIDQNQSDDGDTETSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSAL
SAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRH
WVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLE
EITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIM
KTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSA
IFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFI
EEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL
YESSLRIEPKLPT
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaatgatggccacgtcgcgtccctgggactgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctttacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
ccggcgctgtcggccaaggagccgctggagaaacagcattacttcacggtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggacgcaaaagattgtgacgaatgg
gtggcagccattgcacatgccagctacaggaccctcgccacagagcatgaggcattaatg
cagaaatacctgcacctgctgcagatcgtggagacagagaagaccgtggccaagcagctt
cggcagcagatcgaggatggggagatcgagatcgagcggctgaaggcagagatcgcatcc
ctgctcaaggacaatgagcgcatccagtccacccagactgtcgcccccaacgatgaagac
agcgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgg
aagtggaagaccatcatccaggactacatccggtcaccccatgctgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggctgaggctgagtacgtgcagcagctgcac
atccttgtcaacaatttcctgcgcccgctgcggatggccgccagctccaagaagcctccc
atcacacacgacgacgtcagcagcatcttcctgaacagcgaaaccatcatgtttttgcat
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccacgctggtcctggct
gacctatttgacatcctgctgcccatgctcaacatctaccaagagttcgtccgcaaccac
cagtacagcctgcagatcctggcccactgcaagcagaaccgtgacttcgacaagctgctg
aagcactacgaggccaagcctgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatcctgaccctccatgagctcctggcccacacgcct
catgagcacgttgagcgcaacagcctggactacgccaagtccaaactggaggagctgtcc
agaataatgcacgatgaagtaagtgagacggagaacatccggaaaaacctggccatcgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagacctttgtgagacaa
ggttccctcattcaggtgcccatgtctgaaaagggcaagatcaccagggggcgcctgggg
tctctctccctaaagaaagagggcgagcgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggctctggagggaagcttcacttgaccaagaatggagtcatatccctc
attgactgcactttattggaggagccagaaagcacggaggaggaagccaaaggatccggc
caagacatagatcacttggattttaaaatcggggtggagccaaaggattccccgcccttt
acggtcatcctagtggcctcgtccagacaggagaaggcagcgtggaccagtgacatcagc
cagtgtgtggataacatccgatgcaatgggctcatgatgaacgcatttgaagaaaattcc
aaggtcactgtgccgcagatgatcaagaggaccagggaggggaccagggaagcagaaatg
agcaggtccgacgcctccttatattgtgatgatgttgacattcgcttcagcaaaaccatg
aactcctgcaaagtgctgcagatccgctacgccagtgtggagcggctgctggagaggctg
acggacctgcgcttcctgagcatcgacttcctcaacaccttcctgcactcctaccgcgtc
ttcaccaccgccatcgtggtcctggacaagctcattaccatctacaagaagcctatcagt
gccattcctgccaggtggctgaggtcgctggagctcctgtttgccagtggccagaacaat
aagctcctgtacggtgaaccccccaagtccccgcgcgccacccgcaagttctcctcgccg
ccacctctgtccatcaccaagacatcgtcaccgagccgccggcggaagctctccctgaac
atccccatcatcaccggcggcaaggccctggacctggccgccctcagctgcaactccaat
ggctacaccagcatgtactcggccatgtcgcccttcagcaaggccacgctggacaccagc
aagctctatgtgtccagcagcttcaccaacaagattccagatgagggcgatacgacccct
gagaagcccgaagacccttcggcgctcagcaagcagagctcagaagtctccatgagagag
gagtcagatattgatcaaaaccagagtgatgatggtgatactgaaacatcaccaactaaa
tctccaacaacacccaaatcagtcaaaagcaaaaattcttcagagttcccgctcttttcc
tataacaatggagtcgtcatgacctcctgtcgtgaactggacaataaccgcagtgccttg
tcggccgcctctgcctttgccatagcaaccgcgggggccaacgagggcaccccaaacaag
gagaagtaccggaggatgtccttagccagtgcagggtttcccccagaccagaggaatgga
gacaaggagtttgtgatccgcagagcagccaccaatcgtgtcttgaacgtgctccgccac
tgggtgtccaagcactctcaggactttgagaccaacgatgagctcaaatgcaaggtgatc
ggcttcctggaagaagtcatgcacgacccggagctcctgacccaggagcggaaggctgca
gccaacatcatcaggactctgacccaggaggacccaggtgacaaccagatcacgctggag
gagatcacgcagatggctgaaggcgtgaaggctgagccctttgaaaaccactcagccctg
gagatcgcggagcagctgaccctgctagatcacctcgtcttcaagaagattccttatgag
gagttcttcggacaaggatggatgaaactggaaaagaatgaaaggaccccttatatcatg
aaaaccactaagcacttcaatgacatcagtaacttgattgcttcagaaatcatccgcaac
gaggacatcaacgccagggtgagcgccatcgagaagtgggtggccgtagctgacatatgc
cgctgcctccacaactacaatgccgtactggagatcacctcgtccatgaaccgcagtgca
atcttccggctcaaaaagacgtggctcaaagtctctaagcagactaaagctttgattgat
aagctccaaaagcttgtgtcatctgagggcagatttaagaatctcagagaagctctgaaa
aattgtgacccaccctgtgtcccttacctggggatgtacctcaccgacctggccttcatc
gaggaggggacgcccaattacacggaagacggcctggtcaacttctccaagatgaggatg
atatcccatattatccgagagattcgccagtttcaacaaactgcctacaaaatagagcac
caagcaaaggtaacgcaatatttactggaccaatcttttgtaatggatgaagaaagcctc
tacgagtcttctctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system