KEGG   Pan paniscus (bonobo): 100994899Help
Entry
100994899         CDS       T02283                                 

Gene name
RASGRF1
Definition
Ras protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100994899 (RASGRF1)
   04010 MAPK signaling pathway
    100994899 (RASGRF1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100994899 (RASGRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1273 aa AA seqDB search
MQKGIRLNDGHVASLGLLARKDGTRKGYLSKRSSDNTKWQTKWFALLQNLLFYFESDSSS
RPSGLYLLEGCVCDRAPSPKPALSAKEPLEKQHYFTVNFSHENQKALELRTEDAKDCDEW
VAAIAHASYRTLATEHEALMQKYLHLLQIVETEKTVAKQLRQQIEDGEIEIERLKAEIAS
LLKDNERIQSTQTVAPNDEDSDIKKIKKVQSFLRGWLCRRKWKTIIQDYIRSPHADSMRK
RNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETIMFLH
QIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDFDKLL
KHYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKLEELS
RIMHDEVSETENIRKNLAIERMIIEGCEILLDTSQTFVRQGSLIQVPMSEKGKITRGRLG
SLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLEEPESTEEEAKGSG
QDIDHLDFKIGVEPKDSPPFTVILVASSRQEKAAWTSDISQCVDNIRCNGLMMNAFEENS
KVTVPQMIKRTREGTREAEMSRSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERL
TDLRFLSIDFLNTFLHSYRVFTTAIVVLDKLITIYKKPISAIPARWLRSLELLFASGQNN
KLLYGEPPKSPRATRKFSSPPPLSITKTSSPSRRRKLSLNIPIITGGKALDLAALSCNSN
GYTSMYSAMSPFSKATLDTSKLYVSSSFTNKIPDEGDTTPEKPEDPSALSKQSSEVSMRE
ESDIDQNQSDDGDTETSPTKSPTTPKSVKSKNSSEFPLFSYNNGVVMTSCRELDNNRSAL
SAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNGDKEFVIRRAATNRVLNVLRH
WVSKHSQDFETNDELKCKVIGFLEEVMHDPELLTQERKAAANIIRTLTQEDPGDNQITLE
EITQMAEGVKAEPFENHSALEIAEQLTLLDHLVFKKIPYEEFFGQGWMKLEKNERTPYIM
KTTKHFNDISNLIASEIIRNEDINARVSAIEKWVAVADICRCLHNYNAVLEITSSMNRSA
IFRLKKTWLKVSKQTKALIDKLQKLVSSEGRFKNLREALKNCDPPCVPYLGMYLTDLAFI
EEGTPNYTEDGLVNFSKMRMISHIIREIRQFQQTAYKIEHQAKVTQYLLDQSFVMDEESL
YESSLRIEPKLPT
NT seq 3822 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaggggatccggctgaatgatggccacgtcgcgtccctgggactgctggcgcgc
aaggacggcacgcgcaaaggctacctgagcaagcggagttcggacaacacaaaatggcaa
accaagtggttcgcgctgctgcagaacctgctcttctacttcgagagcgactcgagctcg
cggccctcggggctttacctgctggagggctgcgtctgcgaccgcgcgccctcccccaag
ccggcgctgtcggccaaggagccgctggagaaacagcattacttcacggtgaacttcagc
catgagaaccagaaagccttggagctgaggacagaggacgcaaaagattgtgacgaatgg
gtggcagccattgcacatgccagctacaggaccctcgccacagagcatgaggcattaatg
cagaaatacctgcacctgctgcagatcgtggagacagagaagaccgtggccaagcagctt
cggcagcagatcgaggatggggagatcgagatcgagcggctgaaggcagagatcgcatcc
ctgctcaaggacaatgagcgcatccagtccacccagactgtcgcccccaacgatgaagac
agcgacatcaagaaaattaagaaggtgcagagcttcctgcggggctggctgtgccggcgg
aagtggaagaccatcatccaggactacatccggtcaccccatgctgacagcatgcgcaag
aggaaccaggtggtgttcagcatgctggaggctgaggctgagtacgtgcagcagctgcac
atccttgtcaacaatttcctgcgcccgctgcggatggccgccagctccaagaagcctccc
atcacacacgacgacgtcagcagcatcttcctgaacagcgaaaccatcatgtttttgcat
cagatcttttaccaaggcctgaaggcccgcatctccagctggcccacgctggtcctggct
gacctatttgacatcctgctgcccatgctcaacatctaccaagagttcgtccgcaaccac
cagtacagcctgcagatcctggcccactgcaagcagaaccgtgacttcgacaagctgctg
aagcactacgaggccaagcctgactgcgaggagaggacgctggagaccttcctcacctac
cccatgttccagatccccaggtacatcctgaccctccatgagctcctggcccacacgcct
catgagcacgttgagcgcaacagcctggactacgccaagtccaaactggaggagctgtcc
agaataatgcacgatgaagtaagtgagacggagaacatccggaaaaacctggccatcgag
cgcatgatcatcgaaggctgtgagatcctcctggacaccagccagacctttgtgagacaa
ggttccctcattcaggtgcccatgtctgaaaagggcaagatcaccagggggcgcctgggg
tctctctccctaaagaaagagggcgagcgacagtgcttcctgttttctaagcatctgatt
atctgtaccagaggctctggagggaagcttcacttgaccaagaatggagtcatatccctc
attgactgcactttattggaggagccagaaagcacggaggaggaagccaaaggatccggc
caagacatagatcacttggattttaaaatcggggtggagccaaaggattccccgcccttt
acggtcatcctagtggcctcgtccagacaggagaaggcagcgtggaccagtgacatcagc
cagtgtgtggataacatccgatgcaatgggctcatgatgaacgcatttgaagaaaattcc
aaggtcactgtgccgcagatgatcaagaggaccagggaggggaccagggaagcagaaatg
agcaggtccgacgcctccttatattgtgatgatgttgacattcgcttcagcaaaaccatg
aactcctgcaaagtgctgcagatccgctacgccagtgtggagcggctgctggagaggctg
acggacctgcgcttcctgagcatcgacttcctcaacaccttcctgcactcctaccgcgtc
ttcaccaccgccatcgtggtcctggacaagctcattaccatctacaagaagcctatcagt
gccattcctgccaggtggctgaggtcgctggagctcctgtttgccagtggccagaacaat
aagctcctgtacggtgaaccccccaagtccccgcgcgccacccgcaagttctcctcgccg
ccacctctgtccatcaccaagacatcgtcaccgagccgccggcggaagctctccctgaac
atccccatcatcaccggcggcaaggccctggacctggccgccctcagctgcaactccaat
ggctacaccagcatgtactcggccatgtcgcccttcagcaaggccacgctggacaccagc
aagctctatgtgtccagcagcttcaccaacaagattccagatgagggcgatacgacccct
gagaagcccgaagacccttcggcgctcagcaagcagagctcagaagtctccatgagagag
gagtcagatattgatcaaaaccagagtgatgatggtgatactgaaacatcaccaactaaa
tctccaacaacacccaaatcagtcaaaagcaaaaattcttcagagttcccgctcttttcc
tataacaatggagtcgtcatgacctcctgtcgtgaactggacaataaccgcagtgccttg
tcggccgcctctgcctttgccatagcaaccgcgggggccaacgagggcaccccaaacaag
gagaagtaccggaggatgtccttagccagtgcagggtttcccccagaccagaggaatgga
gacaaggagtttgtgatccgcagagcagccaccaatcgtgtcttgaacgtgctccgccac
tgggtgtccaagcactctcaggactttgagaccaacgatgagctcaaatgcaaggtgatc
ggcttcctggaagaagtcatgcacgacccggagctcctgacccaggagcggaaggctgca
gccaacatcatcaggactctgacccaggaggacccaggtgacaaccagatcacgctggag
gagatcacgcagatggctgaaggcgtgaaggctgagccctttgaaaaccactcagccctg
gagatcgcggagcagctgaccctgctagatcacctcgtcttcaagaagattccttatgag
gagttcttcggacaaggatggatgaaactggaaaagaatgaaaggaccccttatatcatg
aaaaccactaagcacttcaatgacatcagtaacttgattgcttcagaaatcatccgcaac
gaggacatcaacgccagggtgagcgccatcgagaagtgggtggccgtagctgacatatgc
cgctgcctccacaactacaatgccgtactggagatcacctcgtccatgaaccgcagtgca
atcttccggctcaaaaagacgtggctcaaagtctctaagcagactaaagctttgattgat
aagctccaaaagcttgtgtcatctgagggcagatttaagaatctcagagaagctctgaaa
aattgtgacccaccctgtgtcccttacctggggatgtacctcaccgacctggccttcatc
gaggaggggacgcccaattacacggaagacggcctggtcaacttctccaagatgaggatg
atatcccatattatccgagagattcgccagtttcaacaaactgcctacaaaatagagcac
caagcaaaggtaacgcaatatttactggaccaatcttttgtaatggatgaagaaagcctc
tacgagtcttctctccgaatagaaccaaaactccccacctga

DBGET integrated database retrieval system