KEGG   Pan paniscus (bonobo): 100995074Help
Entry
100995074         CDS       T02283                                 

Gene name
CACNA2D2
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 2
Orthology
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
pps  Pan paniscus (bonobo)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Oxytocin signaling pathway
Hypertrophic cardiomyopathy (HCM)
Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100995074 (CACNA2D2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    100995074 (CACNA2D2)
  Circulatory system
   04260 Cardiac muscle contraction
    100995074 (CACNA2D2)
   04261 Adrenergic signaling in cardiomyocytes
    100995074 (CACNA2D2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100995074 (CACNA2D2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    100995074 (CACNA2D2)
   05414 Dilated cardiomyopathy (DCM)
    100995074 (CACNA2D2)
Ion channels [BR:pps04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100995074 (CACNA2D2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1079 aa AA seqDB search
MSLGMQHWARRLEQEVDGVMRIFGGVQQLREIYKDNRNLFEVQENEPQKLVEKVAGDIES
LLDRKVQALKRLADAAENFQKAHRWQDNIKEEDIVYYDAKADAELDDPESEDVERGSKAN
TLRLDFIEDPNFKNKVNYSYAAVQIPTDIYKGSTVILNELNWTEALENVFMENRRQDPTL
LWQVFGSATGVTRYYPATPWRAPKKIDLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGL
TLKLMKTSVCEMLDTLSDDDYVNVASFNEKAQPVSCFTHLVQANVRNKKVFKEAVQGMVA
KGTTGYKAGFEYAFDQLQNSNITRANCNKMIMMFTDGGEDRVQDVFEKYNWPNRTVRVFT
FSVGQHNYDVTPLQWMACANKGYYFEIPSIGAIRINTQEYLDVLGRPMVLAGKEAKQVQW
TNVYEDALGLGLVVTGTLPVFNLTQDGPGEKKNQLILGVMGIDVALNDIKRLTPNYTLGA
NGYVFAIDLNGYVLLHPNLKPQTTNFREPVTLDFLDAELEDENKEEIRRSMIDGNKGHKQ
IRTLVKSLDERYIDEVTRNYTWVPIRSTNYSLGLVLPPYSTFYLQANLSDQILQVKYFEF
LLPSSFESEGHVFIAPREYCKDLNASDNNTEFLKNFIELMEKVTPDSKQCNNFLLHNLIL
DTGITQQLVERVWRDQDLNTYSLLAVFAATDGGITRVFPNKAAEDWTENPEPFNASFYRR
SLDNHGYVFKPPHQDALLRPLELENDTMGILVSTAVELSLGRRTLRPAVVGVKLDLEAWA
EKFKVLASNRTHQDQPQKQCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQV
GRFFSEVDANLMLALYNNSFYTRKESYDYQAACAPQPPGNLGAAPRGVFVPTVADFLNLA
WWTSAAAWSLFQQLLYGLIYHSWFQADPAEAEGNPETRESSCVMKQTQYYFGSVNASYNA
IIDCGNCSRLFHAQRLTNTNLLFVVAEKPLCSQCEAGRLLQKETHSDGPEQCELVQRPRY
RRGPHICFDYNATEDTSDCGRGASFPPSLGVLVSLQLLLLLGLPPRPQPQVLVHASRRL
NT seq 3240 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgggatgcagcactgggcccggcgtctggagcaggaggtagacggcgtgatg
cggatttttggaggcgtccagcagctccgtgagatttacaaggacaaccggaacctgttc
gaggtacaggagaatgagcctcagaagttggtggagaaggtggcaggggacattgagagc
cttctggacaggaaggtgcaggccctgaagagactggctgatgctgcagagaacttccag
aaagcacaccgctggcaggacaacatcaaggaggaagacatcgtgtactatgacgccaag
gctgacgctgagctggacgaccctgagagtgaggatgtggaaagggggtctaaggccaac
accctaaggctggacttcatcgaggacccaaacttcaagaacaaggtcaactattcatac
gcggctgtacagatccctacggacatctacaaaggctccactgtcatcctcaatgagctc
aactggacagaggccctggagaatgtgttcatggaaaaccgcagacaagaccccacactg
ctgtggcaggtcttcggcagcgccacaggagtcactcgctactacccggccaccccgtgg
cgagcccccaagaagatcgacctgtacgatgtccgaaggagaccctggtatatccagggg
gcctcgtcacccaaagacatggtcatcatcgtggatgtgagtggcagtgtgagtggcctg
accctgaagctgatgaagacatctgtctgcgagatgctggacacgctgtctgatgatgac
tatgtgaatgtggcctcgttcaacgagaaggcacagcctgtgtcatgcttcacacacctg
gtgcaggccaatgtgcgcaacaagaaggtgttcaaggaagctgtgcagggcatggtggcc
aagggcaccacaggctacaaggccggctttgagtatgcctttgaccagctgcagaactcc
aacatcactcgggccaactgcaacaagatgatcatgatgttcacggatggtggcgaggac
cgcgtgcaggacgtctttgagaagtacaattggccaaaccggacggtgcgcgtgtttact
ttctccgtggggcagcataactatgacgtcacaccgctgcagtggatggcctgtgccaac
aaaggctactattttgagatcccttccatcggagccatccgcatcaacacacaggaatat
ctagatgtattgggcaggcccatggtgctggcaggcaaggaggccaagcaggtgcagtgg
accaacgtgtatgaggatgcactgggactggggttggtggtaacagggaccctccctgtt
ttcaacctgacacaggatggccctggggaaaagaagaaccagctgatcctgggcgtgatg
ggcattgacgtggctctgaatgacatcaagaggctgacccccaactacacgcttggagcc
aacggctatgtgtttgccattgacctgaacggctacgtgttgctgcaccccaatctcaag
ccccagaccaccaacttccgggagcctgtgactctggacttcctggatgcggagctagag
gatgagaacaaggaagagatccgtcggagcatgattgatggcaacaagggccacaagcag
atcagaacgttggtcaagtccctggatgagaggtacatagatgaggtgacacggaactac
acctgggtgcctataaggagcactaactacagcctggggctggtgctcccaccctacagc
accttctacctccaagccaatctcagtgaccagatcctgcaggtcaagtattttgagttc
ctgctccccagcagctttgagtctgaaggacatgttttcattgctcccagagagtactgc
aaggacctgaatgcctcagacaacaacaccgagttcctgaaaaactttattgagctcatg
gagaaagtgactccagactccaagcagtgcaacaacttccttctgcacaacctgatcttg
gacacgggcatcacgcagcagctggtagagcgtgtgtggagggaccaggatctcaacacg
tacagcctactggccgtgttcgctgccacagacggtggcatcacccgagtcttccccaac
aaggcagctgaggactggacagagaaccctgagcccttcaatgccagcttctaccgccgc
agcctggataaccacggttatgtcttcaagcccccacaccaggatgccctgttaaggccg
ctggagctggagaatgacaccatgggcatcctcgtcagcacagctgtggagctcagccta
ggcaggcgcacactgaggccagcagtggtgggcgtcaagctggacctagaggcttgggct
gagaagttcaaggtgctagccagcaaccgtacccaccaagaccagcctcagaagcagtgc
ggccccaacagccactgtgagatggactgcgaggttaacaatgaggacttactgtgtgtc
cttattgatgatggaggattcctggtgctgtcaaaccagaaccatcagtgggaccaggtg
ggcaggttcttcagtgaggtggatgccaacctgatgctggcactctacaataactccttc
tacacccgcaaggagtcctatgactatcaggcagcctgtgcccctcagccccctggcaac
ctgggtgctgcaccccggggtgtctttgtgcccaccgttgcagatttccttaacctggcc
tggtggacctctgctgccgcctggtccctgttccagcagcttctctacggcctcatctac
cacagctggttccaagcagaccccgcggaggccgaggggaaccccgagacgcgcgagagc
agctgcgtcatgaaacagacccagtactacttcggctcggtaaacgcctcctacaacgcc
atcatcgactgcggaaactgctccaggctgttccacgcgcagagactgaccaacaccaat
cttctctttgtggtggccgagaagccgctgtgcagccagtgcgaggctggccggctgctg
cagaaggagacgcactcggacggcccggagcagtgtgagctagtgcagagaccgcgatac
cggagaggcccgcacatctgcttcgactacaacgcgacagaagatacctcagactgtggc
cgcggggcctccttcccgccgtcgctgggcgtcctggtctccctgcaactgctgctcctc
ctgggcctgccgccccggccgcagcctcaagtcctcgtccacgcctctcgccgcctctga

DBGET integrated database retrieval system