KEGG   Pan paniscus (bonobo): 100995101Help
Entry
100995101         CDS       T02283                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
pps  Pan paniscus (bonobo)
Pathway
Endocytosis
Phagosome
Tuberculosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:pps04144]
Cellular Processes; Transport and catabolism; Phagosome [PATH:pps04145]
Human Diseases; Infectious diseases; Tuberculosis [PATH:pps05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1411 aa AA seqDB search
MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
EAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EERSLREAAEQKMTHLTEELNKEATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNEL
TQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDYQQLQSRLSASETSL
HRIHVELSEKGEATQKLKEELSEVETKYQHLKVEFKQLQQQREEKEQHGLQLQSEINQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENIS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHD
QVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTA
QRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLS
LEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKEI
VSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQEFETLSQEAKIQHEELNNRIQTTVTE
LQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQ
LQVQMENTLKEQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGN
INELKQSSEQKKKQIEALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNN
YEKSQETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQEL
KTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEI
TKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQV
KKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNI
FCAECSAKNALTPSSKKPVRVCDACFNDLQG
NT seq 4236 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggaggattttacagaggactcctgggagagttggctctcaaggttctgattta
gattcatcagcaactcctataaacacagtggacgtcaataatgaaagctcttcagagggt
ttcatatgtccccagtgtatgaaatctcttggatctgctgatgaacttttcaaacattat
gaagctgttcatgatgctggtaatgactcaggtcatggaggagagtctaatcttgctttg
aagcgagatgatgtaacactgctcagacaagaggtccaagacctacaggcttcacttaag
gaagaaaaatggtactcggaagaattaaagaaggaattagaaaaatatcaagggctgcag
cagcaagaggccaaacctgatgggttggtgactgattcatcagcagaactacagtctttg
gaacagcaattagaagaagcccaaacagaaaattttaatattaagcaaatgaaagactta
tttgaacagaaagcagcccaacttgctactgaaattgcagatataaagtcaaagtatgat
gaagaaaggagtcttcgagaagctgctgaacaaaaaatgacacatctgacagaagaatta
aacaaagaggcaactgtaattcaagatctgaagacggaactgcttcagagacctggtata
gaagatgttgccgtgctaaagaaagaactggtccaagttcaaacactaatggataacatg
accttggaacgtgagcgagaatctgaaaaactcaaagatgaatgcaaaaaattgcagtca
caatatgctagctcagaggccacaataagccagctaaggagtgaacttgccaaaggcccc
caggaagttgctgtatatgtacaggaactacaaaaactgaaaagttcagttaatgaatta
acacaaaaaaatcagaccttgacagaaaacttgctgaaaaaagaacaagactatactaag
ttagaggagaaacataatgaagaatctgtgagtaaaaagaatattcaggcaacccttcat
caaaaagacctcgattatcaacagcttcagtcaagattgtctgcatctgaaacctcactg
catagaatacatgtagaactaagtgaaaaaggagaagctactcaaaagctcaaagaagaa
ttatctgaggtagagaccaagtaccagcatctaaaggtggagtttaagcagctacaacaa
cagagagaagaaaaggagcagcatgggttacaactccaaagtgaaattaatcaattacat
agcaaacttctggagacagagcgccaactaggggaagctcatggtaggctgaaggaacag
agacagctttcaagtgaaaagttgatggataaagaacaacaagtggctgatttacaactc
aaactttctcggttagaagagcagttgaaggaaaaagttacaaattctacagaattgcag
catcaattagataaaacaaagcaacagcatcaagaacaacaggctcttcagcaaagcacc
acggcaaaacttcgagaagctcagaatgatttggaacaagttctacgtcaaattggcgat
aaggaccaaaagatccagaaccttgaagctttattacagaagagtaaagaaaatatttca
ttactagaaaaagaaagagaagatctttatgcaaaaattcaggctggtgaaggagagact
gctgttcttaaccagttacaagaaaaaaaccatacactacaggagcaagtaactcaacta
acagagaagttgaagaatcagtcagaaagtcataaacaagcccaggagaatttgcatgac
caggtacaagagcagaaggcacatcttagagctgcacaagaccgtgtcctttccctagaa
actagtgtcaatgaattaaatagtcaattaaatgaaagcaaggagaaggtctcccagctt
gacatacagattaaagccaaaaccgaactattgctatcagcagaagcagcaaaaactgct
caaagagctgatcttcagaatcatctggacacagctcaaaatgcattacaagataaacag
caggagttaaataagattactactcagttggatcaggtcactgcaaagttacaagacaag
caagaacattgcagtcagctggaaagtcatcttaaagaatataaagagaaatacctctct
ttagaacagaaaaccgaagagctagaaggtcaaattaagaaactagaagctgatagtctt
gaagttaaagcaagcaaggagcaggctttgcaagatctacaacagcaaagacagctgaac
acagatttagagctcagagccacagaattgagtaaacaacttgaaatggagaaggaaata
gtatccagtacaagactggatctacagaaaaaatctgaagcccttgaaagtatcaagcaa
aagcttaccaagcaagaggaagaaaaaaaaatcctgaaacaagaatttgaaactttaagt
caagaagcaaagattcagcatgaggaattgaataacagaattcaaacaacagtaacagaa
ctacaaaaagtgaaaatggagaaagaagctttaatgacagagctttctacagtaaaggac
aaactatcaaaagtttctgattctttgaaaaactctaaaagtgaatttgaaaaggagaat
cagaaaggaaaagccgctatattagacttggaaaaaacttgcaaagaattaaagcatcaa
cttcaagtgcagatggaaaacacacttaaggaacagaaggaactgaaaaagtcacttgaa
aaagagaaggaggcttctcatcagttgaaattggaactcaattcaatgcaggaacaactt
atacaggcccagaatactttaaaacaaaacgaaaaagaagagcaacaacttcaggggaac
ataaatgagctaaagcaatcaagtgaacagaagaaaaaacaaattgaagcactccaagga
gagcttaaaattgctgttttacagaagacagagcttgagaataaactacagcagcagtta
acacaggcagcccaggaacttgcagcagagaaagagaaaatatcagtattacaaaacaac
tatgaaaaaagtcaggaaactttcaaacagcttcaatctgatttctatgggagggaatct
gaacttctagccaccaggcaagatcttaagtctgtagaagagaagctttctctagcacag
gaggacttgatttcaaacagaaatcaaattggaaatcaaaataaattgattcaagaactg
aagactgccaaggctacattggagcaggattcagcaaagaaagaacagcaattgcaggag
cgatgtaaagcactacaagacattcagaaagaaaagtcactgaaagaaaaagaactggta
aatgagaagtctaaattggcagagatagaagaaattaaatgtagacaagaaaaagaaatc
actaaactaaacgaagaactcaagtcccacaaactagaaagcataaaggagataacaaat
cttaaagatgctaaacagcttctaattcagcagaaattagaacttcaaggaaaagcggac
tccctgaaggcagctgttgaacaggagaagagaaatcagcagatactaaaagaccaggtg
aaaaaggaagaagaggagctgaagaaagaatttattgagaaagaagctaagttgcattcc
gaaataaaagaaaaggaagtaggaatgaagaagcatgaagaaaatgaggctaaacttacc
atgcagattacagcattaaatgaaaacttaggcactgtgaagaaggagtggcaatctagt
caacggagagttagtgagcttgagaaacaaacggatgacttacggggtgaaattgcagta
ttagaagcaacggttcagaataatcaagatgaaaggagagcactactggaaagatgtctt
aaaggagaaggtgaaatagaaaagcttcaaaccaaagtattagaattgcaaagaaagctg
gataatacaactgcagcagtgcaggagctgggcagagaaaaccaatcacttcagatcaaa
catacacaagcgttgaatagaaagtgggccgaagacaatgaagtacaaaactgtatggcc
tgtgggaaaggcttttcagtaacagtgagacggcatcactgccgacagtgtggaaatatc
ttctgtgctgaatgttcagccaaaaatgccttaactccttcctccaagaagcctgttcgt
gtctgtgatgcatgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system