KEGG   Pan paniscus (bonobo): 100995179Help
Entry
100995179         CDS       T02283                                 

Gene name
LYZL6
Definition
lysozyme-like 6
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 148 aa AA seqDB search
MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS
KINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA
RGMNNWVEWRLHCSGQPLSYWLTGCRLR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaggcgctactcatctatttggtcagcagctttcttgccctaaatcaggccagc
ctcatcagtcgctgtgacttggcccaggtgctgcagctggaggacttggatgggtttgag
ggttactccctgagtgactggctgtgcctggcttttgtggaaagcaagttcaacatatca
aagataaatgaaaatgcagatggaagctttgactatggcctcttccagatcaacagccac
tattggtgcaacgattataagagttactcggaaaacctttgccacgtagactgtcaagat
ctgctgaatcccaaccttcttgcaggcatccactgcgcaaaaaggattgtgtccggagca
cgggggatgaacaactgggtagaatggaggttgcactgttcaggccagccactctcctac
tggctgacaggatgccgcctgagatga

DBGET integrated database retrieval system