KEGG   Pan paniscus (bonobo): 100995305Help
Entry
100995305         CDS       T02283                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
pps  Pan paniscus (bonobo)
Brite
Enzymes [BR:pps01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100995305 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 355 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAEAVPS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctc
ccggagatcttcgaccccccggaggagctggagcggaaggtgtgggaactggcgaggctg
gtctggcagtcttccaatgtggtgttccacacgggtgccggcatcagcactgcctctggc
attcccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctggccccc
aagttcgacaccacctttgagagcgcgcggcccacgcagacccatatggcgctggtgcag
ctggagcgcgtgggcctcctccgcttcctggtcagccagaacgtggacgggctccatgtg
cgctcaggcttccccagggacaaactggcagagcttcacgggaacatgtttgtggaagaa
tgtgccaagtgtaagacgcagtacgtccgggacacagtcgtgggcaccatgggcctgaag
gccacgggccggctctgcaccgtggctaaggcaagggggctgcgagcctgcaggggagag
ctgagggacaccatcctcgactgggaggactccctgcccgaccgggacctggcactcgcc
gatgaggccagcaggaacgccgacctgtccatcacgctgggtacatcgctgcagatccgg
cccagcgggaacctgccgctggctaccaagcgccggggaggccgcctggtcatcgtcaac
ctgcagcccaccaagcacgaccgccatgctgacctccgcatccatggctacgttgacgag
gtcatgacccggctcatgaagcacctggggctggagatccccgcctgggacggcccccgt
gtgctggagagggcgctgccacccctgccccgcccgcccacccccaagctggagcccaag
gaggaatctcccacccggatcaacggctctatccccgccggccccaagcaggagccctgc
gcccagcacaacggctcagagcccgccagccccaaacgggagcggcccaccagccctgcc
ccccacagaccccccaaaagggtgaaggccgaggcggtccccagctga

DBGET integrated database retrieval system