KEGG   Pan paniscus (bonobo): 100995483Help
Entry
100995483         CDS       T02283                                 

Gene name
RNASE1
Definition
ribonuclease, RNase A family, 1 (pancreatic)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
pps  Pan paniscus (bonobo)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 156 aa AA seqDB search
MALEKSLVLLPLLVLILLVLGWVQPSLGKESRAKKFQRQHVDSDSSPSSSSTYCNQMMRR
RNMTQGRCKPVNTFVHEPLVDVQNVCFQEKVTCKNGQGNCYKSNSSMHITDCRLTNGSRY
PNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggctctggagaagtctcttgtcctgctccctctgcttgtcctgatactgctggtgctg
ggctgggtccagccttccctgggcaaggaatcccgggccaagaaattccagcggcagcat
gtggactcagacagttcccccagcagcagctccacctactgtaaccaaatgatgaggcgc
cggaatatgacacaggggcggtgcaaaccagtgaacacctttgtgcacgagcccctggta
gatgtccagaatgtctgtttccaggaaaaggtcacctgcaagaacgggcagggcaactgc
tacaagagcaactccagcatgcacatcacagactgccgcctgacaaacggctccaggtac
cccaactgtgcataccggaccagcccgaaggagagacacatcattgtggcctgtgaaggg
agcccatatgtgccagtccacttcgatgcttctgtggaggactccacctaa

DBGET integrated database retrieval system