KEGG   Pan paniscus (bonobo): 100995518Help
Entry
100995518         CDS       T02283                                 

Gene name
KCNMB3
Definition
potassium large conductance calcium-activated channel, subfamily M beta member 3
Orthology
K04939  
potassium large conductance calcium-activated channel subfamily M beta member 3
Organism
pps  Pan paniscus (bonobo)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:pps04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:pps04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 206 aa AA seqDB search
MDFSPSSELGFHFVAFILLTRHRTAFPASGKKRETDYSDGDPLDVHKRLPSSAGEDRAVM
LGFAMMGFSVLMFFLLGTTILKPFMLSIQREESTCTAIHTDIMDDWLDCAFTCGVHCHGQ
GKYPCLRVFVNLSHSGQKALLHYNEEAVQINPKCFYTPKCHQDRNDLLNSALDIKEFFDH
KNGTPFSCFYSPASQSEDVILIKKYD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggacttttcaccaagctctgaactgggatttcattttgttgcattcatcctgctcacg
agacacaggacagcctttcctgcctcagggaagaagagagagacagactacagtgatgga
gacccactagatgtgcacaagaggctgccatccagtgctggagaggaccgagccgtgatg
ctggggtttgccatgatgggcttctcagtcctaatgttcttcttgctcggaacaaccatt
ctaaagccttttatgctcagcattcagagagaagaatcaacctgcactgccatccacaca
gatatcatggacgactggctggactgtgccttcacctgtggtgtgcactgccacggtcag
gggaagtacccgtgtcttcgggtgtttgtgaacctcagccattcaggtcagaaagctctc
ctacattataatgaagaggctgtccagataaatcccaagtgcttttacacacctaagtgc
caccaagatagaaatgatttgctcaacagtgctctggacataaaagaattctttgatcac
aaaaatggaacccccttttcatgcttctacagtccagccagccaatctgaagatgtcatt
cttataaaaaagtatgactaa

DBGET integrated database retrieval system