KEGG   Pan paniscus (bonobo): 100995582Help
Entry
100995582         CDS       T02283                                 

Gene name
CDKN2D
Definition
(RefSeq) cyclin dependent kinase inhibitor 2D
  KO
K06623  cyclin-dependent kinase inhibitor 2D
Organism
pps  Pan paniscus (bonobo)
Pathway
pps04068  FoxO signaling pathway
pps04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100995582 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100995582 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_5 Ank_2 Ank_4 Ank Ank_3
Motif
Other DBs
NCBI-GeneID: 100995582
NCBI-ProteinID: XP_014197948
Position
19
AA seq 208 aa AA seqDB search
MSSQAFPRRAPGNAVPLHSSEFVRKQIRGVRGVAGSTLAPPPGGCLSGGGGAGSEQTPPG
EEEGGVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPV
HDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR
GLTPLELALQRGAQDLVDILQGHMVAPL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcaggccttcccacgtcgcgcgccgggcaacgcggtgccgctacacagtagc
gagtttgtaagaaaacaaatccgcggcgttcggggtgtggccgggagcacgttggcacca
ccccctggcggctgcctcagcggcggcggcggcgcaggctcagagcagaccccgcccggc
gaggaggagggaggggtgcgccgccttctgcaccgcgagctggtgcatcccgacgccctt
aaccgcttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctg
gagctgctgaagcaaggtgccagccccaatgtccaggacacctccggtaccagtccagtc
catgacgcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggct
gatgtcaacgtgcctgatggcaccggggcacttccaatccatctggcagttcaagagggt
cacactgctgtggtcagctttctggcagctgaatctgatctccatcgcagggacgccagg
ggtctcacacccttggagctggcactgcagagaggggctcaggacctcgtggacatcctg
cagggccacatggtggccccgctgtga

DBGET integrated database retrieval system