KEGG   Pan paniscus (bonobo): 100995582Help
Entry
100995582         CDS       T02283                                 

Gene name
CDKN2D
Definition
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
Orthology
K06623  
cyclin-dependent kinase inhibitor 2D
Organism
pps  Pan paniscus (bonobo)
Pathway
FoxO signaling pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100995582 (CDKN2D)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    100995582 (CDKN2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 208 aa AA seqDB search
MSSQAFPRRAPGNAVPLHSSEFVRKQIRGVRGVAGSTLAPPPGGCLSGGGGAGSEQTPPG
EEEGGVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPV
HDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDAR
GLTPLELALQRGAQDLVDILQGHMVAPL
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcaggccttcccacgtcgcgcgccgggcaacgcggtgccgctacacagtagc
gagtttgtaagaaaacaaatccgcggcgttcggggtgtggccgggagcacgttggcacca
ccccctggcggctgcctcagcggcggcggcggcgcaggctcagagcagaccccgcccggc
gaggaggagggaggggtgcgccgccttctgcaccgcgagctggtgcatcccgacgccctt
aaccgcttcggcaagacggcgctgcaggtcatgatgtttggcagcaccgccatcgccctg
gagctgctgaagcaaggtgccagccccaatgtccaggacacctccggtaccagtccagtc
catgacgcagcccgcactggattcctggacaccctgaaggtcctagtggagcacggggct
gatgtcaacgtgcctgatggcaccggggcacttccaatccatctggcagttcaagagggt
cacactgctgtggtcagctttctggcagctgaatctgatctccatcgcagggacgccagg
ggtctcacacccttggagctggcactgcagagaggggctcaggacctcgtggacatcctg
cagggccacatggtggccccgctgtga

DBGET integrated database retrieval system