KEGG   Pan paniscus (bonobo): 100995726Help
Entry
100995726         CDS       T02283                                 

Gene name
PRSS3
Definition
protease, serine, 3
Orthology
K01312  
trypsin [EC:3.4.21.4]
Organism
pps  Pan paniscus (bonobo)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100995726 (PRSS3)
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    100995726 (PRSS3)
   04974 Protein digestion and absorption
    100995726 (PRSS3)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    100995726 (PRSS3)
Enzymes [BR:pps01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     100995726 (PRSS3)
Peptidases [BR:pps01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100995726 (PRSS3)
Exosome [BR:pps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100995726 (PRSS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 305 aa AA seqDB search
MCGPDDRCPARWPRPGRAVKCGKGLAAARPGGVERGGAQGRGGAGLELHPLLGGRTWRAA
RDADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAA
HCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINAR
VSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNS
MFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDT
IAANS
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggacctgacgacagatgccccgcacgctggccgagaccgggaagggcggtcaag
tgtggaaaggggctggcggctgccaggcctggcggagtggagcggggcggggcgcagggg
cggggcggggcgggcctggagctgcacccgcttctgggtggacgcacttggcgcgctgcg
cgggatgcagacggctgcgaggcgctgggcacagttgctgtcccctttgacgatgatgac
aagatcgttgggggctacacctgtgaggagaattctctcccctaccaggtgtccctgaat
tctggctcccacttctgcggtggctccctcatcagcgaacagtgggtggtatcagcagct
cactgctacaagacccgcatccaggtgagactgggagagcacaacatcaaagtcctggag
gggaatgagcagttcatcaatgcggccaagatcatccgccaccccaaatacaacagggac
actctggacaatgacatcatgctgatcaaactctcctcacctgccgtcatcaatgcccgc
gtgtccaccatctctctgcccaccgcccctccagctgctggcactgagtgcctcatctcc
ggctggggcaacactctgagctttggtgctgactatccagacgagctgaagtgcctggat
gctccggtgctgacccaggctgagtgtaaagcctcctaccctggaaagattaccaacagc
atgttctgtgtgggcttccttgagggaggcaaggattcctgccagcgtgactctggtggc
cctgtggtctgcaacggacagctccaaggagttgtctcctggggccatggctgtgcctgg
aagaacaggcctggagtctacaccaaggtctacaactatgtggactggattaaggacacc
atcgctgccaacagctaa

DBGET integrated database retrieval system