KEGG   Pan paniscus (bonobo): 100995808Help
Entry
100995808         CDS       T02283                                 

Gene name
KMT2D, MLL2
Definition
lysine (K)-specific methyltransferase 2D
Orthology
K09187  
histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
pps  Pan paniscus (bonobo)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100995808 (KMT2D)
Enzymes [BR:pps01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100995808 (KMT2D)
Transcription factors [BR:pps03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100995808 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 5369 aa AA seqDB search
MDSQKLAGEDKDSEPAADGPAASEDPSATESDLPNPHVGEVSVLSSGSARLQETPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPRCPVVSPGGSPGPNEAVLPSEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRLGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAQGGQPIRS
VAEQHTPVCSRFSPPEPGDTHTDEPDALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
RAGVQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPASPLP
EALHLSRPPEESPLSPPPLSPPPEESPTSPPPEASRLSPPPEDSPTSPPPEDSPASPPPE
DSLMSLPLEESPLSPLPEEPQLCPPSEGPHLSPRPEEPHLSPRPEEPHLSPQAEEPHLSP
QPEEPCLCAVPEEPHLXPQAEGPHLSPQPEELHLSPQTEEPHLSPVPEEPCLSPQPEESH
LSPQSEEPCLSPRPEESHLSPQLEKPPLSPRPEEPPEEPGQCPAPEELPLFPPPGEPSLS
PLLGEPALSEPGEPPLSPLPEELPLSPSGEPSLSPQLMPPDPLPPPLSPIITAAAPPALS
PLGELEYPFGAKGDSDPESPLAAPILETPISPPPEANCTDPEPVPPMILPPSPGSPMGPA
SPILMEPLPPQCSPLLQHSLVPQNSPPSQCSPPALPLSVPSPLSPIGKVVGVSDEAELHE
METEKVSEPECPALEPSATSPLPSPMGDLSCPAPSPAPALDDFSGLGEDTAPLDGIDAPG
SRPEPGQTLGSLASELKGSPVLLDPEELAPVTPMEVYPECKQTAGQGSPCEEQEEPRAPV
APTPPTLIKSDIVNEISNLSQGDASASFPGSEPLLGSPDPEGGGSLSMELGVSTDVSPAR
DEGSLRLCTDSLPETDDSLLCDAGTAISGGKAEGEKGRRRSSPARSRIKQGRSSSFPGRR
RPRGGAHGGRGRGRARLKSTASSIETLVVADIDSSPSKEEEEEDDDTMQNTVVLFSNTDK
FVLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEV
CGQASDPSRLLLCDDCDISYHTYCLDPPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQ
NSYTHCGPCASLVTCPICHAPYVEEDLLIQCRHCERWMHAGCESLFTEDDVEQAADEGFD
CVSCQPYVVKPVAPVAPPELVPMKVKEPEPQYFRFEGVWLTETGMALLRNLTMSPLHKRR
QRRGRLGLPGEAGLEGSEPSDALGPDDKKDGDLDTDELLKGEGGVEHMECEIKLEGPVSP
DVEPGKEETEESKKRKRKPYRPGIGGFMVRQRKSHTRTKKGPAAQAEVLSGDGQPDEVIP
ADLPAEGAVEQSLAEGDEKKKQQRRGRKKSKLEDMFPAYLQEAFFGKELLDLSRKALFAV
GVGRPSFGLGTPKAKGDGGSERKELPTSQKGDDGPDIADEESRGLEGKADTPGPEDGGVK
ASPVPSDPEKPGTPGEGMLSSDLDRISTEELPKMESKDLQQLFKDVLGSEREQHLGCGTP
GLEGSRTPLQRPFLQGGLPLGNLPSSSPMDSYPGLCQSPFLDSRERGGFFSPEPGEPDSP
WTGSGGTTPSTPTTPTTEGEGDGLSYNQRSLQRWEKDEELGQLSTISPVLYANINFPNLK
QDYPDWSSRCKQIMKLWRKVPAADKAPYLQKAKDNRAAHRINKVQKQAESQINKQTKVGD
IARKTDRPALHLRIPPQPGALGSPPPAAAPTIFIGSPTTPAGLSTSADGFLKPPAGSVPG
PDSPGELFLKLPPQVPAQVPSQDPFGLAPAYPLEPRFPTAPPTYPPYPSPTGAPAQPPML
GASSRPGAGQPGEFHTTPPGTPRHQPSTPDPFLKPRCPSLDNLAVPESPGVGGGKASEPL
LSPPPFGESRKALEVKKEELGASSPSYGPPNLGFVDSPSSGTHLGGLELKTPDVFKAPLT
PRASQVEPQSPGLGLRPQEPPPAQALAPSPPSHPDIFRPGSYPDPYAQPPLTPRPQPPPP
ESCCALPPRSLPSDPFSRVPASPQSQSSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSR
PPSRPQSRDPFAPLHKPPRPQPPEVAFKAGSLAHTSLGAGGFPAALPSGPAGELHAKVPS
GQPPNFVRSPGTGAFVGTPSPMRFTFPQAVGEPSLKPPVPQPGLPPPHGINSHFGPGPTL
GKPQSTNYTVATGNFHPSGSPLGPSSGSTGESYGLSPLRPPSVLPPPAPDGSLPYLSHGA
SQRSGITSPVEKREDPGTGMGSSLATAELPGTQDPGMSGLSQTELEKQRQRQRLRELLIR
QQIQRNTLRQEKETAAAAAGAVGPPGSWGAEPSSPAFEQLSRGQTPFAGTQDKSSLVGLP
PSKLSGPILGPGSFPSDDRLSRPPPPATPSSMDVNSRQLVGGSQAFYQRAPYPGSLPLQQ
QQQQLWQQQQATAATSMRFAMSARFPSTPGPELGRQALGSPLAGISTRLPGPGEPVPGPA
GPAQFIELRHNVQKGLGPGGTPFPGQGPPQRPRFYPVSEDPHRLAPEGLRGLAVSGLPPQ
KPSAPPAPELNNSLHPTPHTKGPTLPTGLELVNRPPSSTELGRPTPLALEAGKLPCEDPE
LDDDFDAHKALEDDEELAHLGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAY
TDPELDTGDKKDIFNEHLRLVESANEKAEREALLRGVEPGPLGPEERPPPAADASEPRLA
SVLPEVKPKVEEGGRHPSPCQFTIATPKVEPAPAANSLGLGLKPGQSMMGSRDTRMGTGP
FSSSGHTAEKASFGATGGPPAHLLTPSPLSGPGGSSLLEKFELESGALTLPGGPAASGDE
LDKMESSLVASELPLLIEDLLEHEKKELQKKQQLSAQLQPAQQQQQQQQQHSLLSAPGPA
QAISLPHEGSSPSLAGSQQQLSLGLAGARQPGLPQPLMPTQPPAHALQQRLAPSMAMVSN
QGHMLSGQHGGQAGLVPQQSSQPVLSQKPMGTMPPSMCMKPQQLAMQQQLANSFFPDTDL
DKFAAEDIIDPIAKAKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGPGSDLQN
HVAAGSGQERSAGDPSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQI
GVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLM
AEYRNKQQQQQQQQQQQQQQQQHSAVLALSPSQSPRLLTKLPGQLLPGHGLQPPQGPPGG
QAGGLRLPPGGMALPGQPGGPFLNTALAQQQQQQHSGGAGSLAGTSGGFFPGNLALRSLG
PDSRLLQERQLQLQQQRMQLAQKLQQQQQQQQQQQQQHLLGQVAIQQQQQQGPGVQTNQA
LGPKPQGLMPPSSHQGLLVQQLSPQPPQGPQGMLGPAQVAVLQQQHPGALGPQGPHRQVL
MTQSRVLSSPQLAQQGQGLMGHRLVTAQQQQQQQQHQQQGSMAGLSHLQQSLMSHSGQPK
LSAQPMGSLQQLQQQQQLQQQQQLQQQQQQQLQQQQQLQQQQLQQQQQQQQLQQQQQQQL
QQQQQQLQQQQQQQQQQFQQQQQQQQMGLLNQSRTLLSPQQQQQQQVALGPGMPAKPLQH
FSSPGALGPTLLLTGKEQNTVDPAVSSEATEGPSTHQGGPLAIGTTPESMATEPGEVKPS
LSGDSQLLLVQPQPQPQPSSLQLQPPLRLPGQQQQQVSLLHTAGGGSHGQLGSGSSSEAS
SVPHLLAQPSVSLGDQPGSMTQNLLGPQQPMLERPMQNNTGPQPPKPGPVLQSGQGLPGV
GIMPTVGQLRAQLQGVLAKNPQLRHLSPQQQQQLQALLMQRQLQQSQAVRQTPPYQEPGT
QTSPLQGLLGCQPQLGGFPGPQTGPLQELGAGPRPQGPPRLPAPPGALSTGPVLGPVHPT
PPPSSPQEPKRPSQLPSPSSQLPTEAQLPPTHPGTPKPQGPTLEPPPGRVSPAAAQLADT
LFSKGLGPWDPPDNLAETQKPEQSSLVPGHLDQVNGQVVPEASQLSIKQEPREEPCALGA
QSVKREANGEPIGAPGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLSTGRGSEGLRAEIN
GHIDSKLAGLEQKLQGTPSNKEDAAARKPLTPKPKRVQKASDRLVSSRKKLRKEDGVRAS
EALLKQLKQELSLLPLTEPAITTNFSLFAPFGSGCPVNGQSQLRGAFGSGALPTGPDYYS
QLLTKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTPSEELGEHPKDAASARDSERALRDT
SEVKSLDLLAALPTPPHNQTEDVRMESDEDSDSPDSIVPASSPESILGEETPRFPHLGSG
RWEQEDRALSPVIPLIPRASIPVFPDTKPYGALDLEVPGKLPVTTWEKGKGSEVSVMLTV
SAAAAKNLNGVMVAVAELLSMKIPNSYEVLFPESPARAGTEPKKGEAEGPGGKEKGLGGK
SPDTGPDWLKQFDAVLPGYTLKSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSA
PPPEEPSPPPSPLAPSPASPPTEPLVELPTEPLAEPPVPSPLPLASSPESARPKPRARPP
EEGEDSRPPRLKKWKGVRWKRLRLLLTIQKGSGRQEDEREVAEFMEQLGTALRPDKVPRD
MRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGL
LTKCSLCQRTGATSSCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSS
FAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPV
GYEATRIYWSLRTNNRRCCYRCSIGENNGRPEFVIKVIEQGLEDLVFTDASPQAVWNRII
EPVAAMRKEADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLME
LPLMINPTGCARSEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQY
RRLRTEWKNNVYLARSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNR
GIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEEL
TYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 16110 nt NT seq  +upstreamnt  +downstreamnt
atggacagccagaagctggctggtgaggataaagattcagaaccggcagctgatggacct
gcagcttctgaggacccaagtgccactgagtcagacctgcccaacccacatgtgggagag
gtctctgtccttagttctgggagtgccaggcttcaggagactcctcaggactgcagtggg
ggtccggtgcggcgttgtgctctctgtaactgcggggagcccagtctacacgggcagcgg
gagctacggcgctttgagttgccatttgattggccccggtgtccagtggtgtcccctggg
gggagcccagggcccaatgaggcagtgctgcccagtgaggacctatcacagattggtttc
cctgagggccttacacctgcccacctaggagaacctggagggtcctgctgggctcaccat
tggtgtgctgcatggtcggcaggcgtatgggggcaggagggcccagaactatgtggtgtg
gacaaggccatcttctcagggatctcacagcgctgctcccactgcaccaggctcggtgcc
tccatcccttgccgctcacctggatgtccacggctttaccacttcccctgcgcgactgcc
agcggttccttcctatccatgaaaacactgcagctgctatgcccagagcacagtgagggg
gctgcacatctggaggaggctcgctgtgcagtgtgtgaggggccaggggagttgtgtgac
ctgttcttctgtaccagctgtgggcatcactatcatggggcctgcctggacactgctctg
actgcccgcaaacgtgctggctggcagtgccctgaatgcaaagtgtgccaagcctgcagg
aaacctgggaatgactctaagatgttggtttgtgagacgtgtgacaaaggataccatact
ttctgcctaaaaccacccatggaggaactgcctgctcactcttggaagtgcaaggcgtgc
cgggtatgtcgggcctgtggggcgggctcagcagaactgaatcccaactcggagtggttt
gagaactactctctctgtcaccgctgtcacaaagcccagggaggtcagcctatccgctcc
gttgctgagcagcataccccggtgtgtagcagattttcacccccagagcctggcgatacc
cacactgatgagcccgatgctctgtacgttgcatgccaagggcagccaaagggtgggcac
gtgacctctatgcaacccaaggaaccagggcccctgcaatgtgaagccaaaccactaggg
agagcaggggtccaacttgagccccagttggaggcccccctaaacgaggagatgccactg
ctgcccccacctgaggagtcacccctgtccccaccacctgaggaatcacccacgtcccca
ccacctgaggcatcacgcctgtccccaccacccgaggaatcgcccgcatccccacttcct
gaggcattgcacctgtcccggccgccagaggaatcgcccctctctccgcctcccttgtcc
ccaccgcctgaggagtctcccacgtcccctccacctgaggcttcacgcctctccccacca
cctgaggactcccccacatccccaccacctgaggactcacctgcttccccaccaccggag
gactcgctcatgtccctgccgctggaggagtcacccctgtcgccactacctgaggagccg
caactctgccccccgtccgaggggccgcacctgtcaccccggcctgaggagccgcacctg
tccccccggcctgaggagccgcacctatctccgcaggctgaggagccacacctgtccccc
cagcctgaggagccatgcctgtgcgctgtgcctgaggagccacacttgntcccccaggct
gagggaccacatctgtcccctcagcctgaggaattgcacctgtccccccagactgaggag
ccgcacctgtctcctgtgcctgaggagccatgcttgtccccccaacctgaggaatcacac
ctgtccccccagtctgaggagccatgcctgtccccccggcctgaggaatcgcatctgtcc
cctcagcttgagaagccacccctgtcccctcggcctgaagagccccctgaggagccaggc
caatgccctgcacctgaggagctgcccttgttccctccccctggggaaccatccttatct
cccttgcttggagagccagccctgtctgagcctggggaaccacctctgtcccctctgccc
gaggagctgccgttgtccccatctggggagccatccttgtcgcctcagctgatgccacca
gatccccttcctcctccactctcacccattatcacagctgcggccccaccggccctgtct
cctttgggggagttagagtacccctttggtgccaaaggggacagtgaccctgagtcaccg
ttggctgcccccatcctggagacacccatcagccctccaccagaagctaactgcactgac
cctgagcctgtccctcctatgatccttcccccatctccaggctccccaatggggccggct
tctcccatcctgatggagccccttcctcctcagtgttcgccactccttcagcattccctg
gttccccaaaactcccctccctcccagtgctctcctcctgccctaccactgtccgttccc
tccccgttgagtcccatagggaaggtagtgggagtctcagatgaggctgagctgcacgag
atggagactgagaaagtttcagaacctgaatgcccagccttggaacccagtgccaccagt
cctctcccttccccaatgggggacctttcctgccccgcccccagccctgccccagccctg
gatgacttctctggcctaggggaagacacagcccctctggatgggattgatgctccgggt
tcacggccagagcctggacagacccttggcagtttggctagtgaacttaaaggctcccct
gtgctcctggaccccgaggagctggcccccgtgacccctatggaggtctaccccgaatgc
aagcagacagcagggcagggctcaccatgtgaagaacaggaagagccacgtgcaccggtg
gcccccacaccacccactctcatcaaatccgacatcgttaacgagatctctaatctgagc
cagggtgatgccagtgccagttttcctggctcagagcccctcctgggctctccagacccg
gaggggggtggctccctgtccatggagctgggggtctctacggatgttagtccagcccga
gatgagggctccctacggctctgtaccgactcactgccagagactgatgactcactattg
tgcgatgctgggacagctatcagcggaggcaaagctgagggggagaaggggcggcggcgc
agctccccagcccgttcccgcatcaaacagggtcgcagcagcagtttcccaggaagacgc
cggcctcgtggaggagcccatggaggacgtggtagaggacgggcccggctaaagtcaact
gcttcttccattgagactctggtagttgctgacattgatagctctcccagtaaggaggag
gaggaagaagatgatgacaccatgcagaataccgtggttctcttctccaacacagacaaa
tttgtcctaatgcaggacatgtgtgtggtatgtggcagctttggccggggggcagagggc
cacctccttgcctgttcgcagtgctctcagtgctatcacccttactgtgtcaacagcaag
atcaccaaggtgatgctgctcaagggctggcgttgtgtggagtgtattgtgtgtgaggtg
tgtggccaggcctccgacccctcacgcctgctgctctgtgatgactgtgatattagctac
cacacatactgcctggaccccccactgctcaccgtccccaagggcggctggaagtgcaag
tggtgtgtgtcctgtatgcagtgtggggctgcttcccctggcttccactgtgaatggcag
aatagttacacacactgtgggccctgtgccagcctggtgacctgccctatctgtcatgct
ccttatgtagaagaggacctactaatccagtgccgccactgtgaacggtggatgcatgca
ggctgtgagagcctcttcacagaggacgatgtggagcaggcagccgatgaaggctttgac
tgtgtctcctgccagccctacgtggtaaagcctgtggcgcctgttgcacctccagagctg
gtgcccatgaaggtgaaagagccagagccccagtactttcgcttcgaaggtgtgtggctg
acagaaactggcatggccttgctgcgtaacctgaccatgtcaccactgcacaagcggcgc
caacggcgaggacggcttggcctcccaggcgaggcaggattggagggttctgagccctca
gatgcccttggccctgatgacaagaaggatggggacctggacactgatgagctgctcaag
ggtgaaggtggtgtggagcacatggagtgcgaaattaaactggagggccccgtcagccct
gatgtggagcctggcaaagaggagaccgaggaaagcaaaaaacgcaagcgtaaaccatat
cggcctggcattggtggtttcatggtgcgacagcggaaatcccacacacgcacgaaaaag
gggcctgctgcacaggcggaggtgttgagtggggatgggcagcccgacgaggtgatacct
gctgacctgcctgcagagggcgccgtggagcagagcttagctgaaggggatgagaagaag
aagcaacagcggcgagggcgcaagaagagcaaactggaggacatgttccctgcttacttg
caggaagccttctttgggaaggagctgctggacctgagccgtaaggccctttttgcagtt
ggggtgggccggccaagctttggactagggaccccaaaagccaagggagatggaggctca
gaaaggaaggaactccccacatcgcagaaaggagatgatggtccagatattgcagatgaa
gaatcccgtggcctcgagggcaaagccgatacaccaggacctgaggatgggggcgtgaag
gcatccccagtgcccagtgaccctgagaagccaggcaccccaggtgaagggatgcttagc
tctgacttagacaggatttccacagaagaactgcccaagatggaatccaaggacctgcag
cagctcttcaaggatgttctgggctctgaacgagaacagcatctgggttgtggaacccct
ggcctagaaggcagccgtacgccactgcagaggccctttcttcaaggtggactccctttg
ggcaatctgccctccagcagcccaatggactcctacccaggcctctgccagtccccgttc
ctggattctagggagcgcgggggcttctttagcccggaacccggtgagcccgacagcccc
tggacgggctcaggtggcaccacgccctccacccccacaacccccaccacggagggtgag
ggcgacggactctcctataaccagcggagtcttcagcgctgggagaaggatgaggagttg
ggccagctgtccaccatctcacccgtgctctatgccaacattaattttcctaatctcaag
caagattacccagactggtcaagccgttgcaaacaaatcatgaagctctggagaaaggtt
ccagcagctgacaaagccccctacctgcaaaaggccaaagataaccgggcagctcaccgc
atcaacaaggtgcagaagcaggctgagagccagatcaacaagcagaccaaggtgggcgac
atagcccgtaagactgaccgaccggccctacatctccgcattcccccgcagccaggggca
ctgggcagcccgccccccgctgctgcccccaccattttcattggcagccccactaccccc
gccggcttgtctacctctgcggacgggttcctgaagccgccggcgggctcggtgcctggc
cctgactcgcctggtgagctcttcctcaagctcccaccccaggtgcccgcccaagtgcct
tcgcaggacccctttggactggcccctgcctatcccctggagccccgcttccccacggca
ccacccacctatcccccctatcctagtcctacgggggcccctgcgcagcccccgatgctg
ggcgcctcatctcgtcctggggctggccagccaggggaattccacactaccccacctggc
acccccagacaccagccctccacacctgacccattcctcaaaccccgctgcccctcgctg
gataacttggctgtgcctgagagccctggggtagggggaggcaaagcttccgagcccctg
ctctcgcccccaccttttggggagtcccggaaggccctagaggtgaagaaggaagagctt
ggggcatcctctcctagctatgggcccccaaacctgggctttgttgactcaccctcctca
ggcacccacctgggtggcctggagttaaagacacctgatgtcttcaaagcccccctgacc
cctcgggcatctcaggtagagccccagagcccgggcttgggcctaagaccccaggagcca
ccccctgcccaggctttggcaccttctcctccaagtcacccggacatctttcgccctggc
tcctaccctgacccatatgctcagcccccattgactcctcggccccaacctccgccccct
gagagctgctgtgctctgccccctcgctcactgccctccgaccctttctcccgagtgcct
gccagtcctcagtcccagtccagctcccagtctccactgacaccccgtcctctgtctgct
gaagctttttgcccatcccccgttacccctcgcttccagtcccctgacccttattctcgc
ccaccctcacgccctcagtcccgtgacccatttgccccattgcataagccaccccgaccc
cagccccctgaagttgcctttaaggctgggtctctagcccacacttcgctgggggctggg
ggtttcccagcagccctgccctcggggccagcaggtgagctccatgccaaggtcccaagt
gggcagccccccaattttgtccggtcccctgggacgggtgcatttgtgggcaccccctct
cccatgcgtttcactttccctcaggcagtaggggagccttccctaaagccccctgtccct
cagcctggtctcccgccaccccatgggatcaacagccattttgggcccggccccaccttg
ggcaagcctcaaagcacaaactacacagtagccacagggaacttccacccatcgggcagc
cccctggggcccagcagcgggtccacaggggagagctatgggctgtccccgctacgccct
ccgtcggttctgccaccacctgcacccgacggatccctcccctacctgtcccatggagcc
tcacagcgatcaggcatcacctctcctgtcgaaaagcgagaagacccagggactggaatg
ggtagctctttggcgacagctgaactcccaggtacccaggacccaggcatgtccggcctt
agccaaacagagctggagaagcaacggcagcgccagcgactacgagagctgctgattcgg
cagcagatccagcgcaacaccctgcggcaggagaaggaaacagctgcagcagctgcagga
gcagtggggcctccaggcagctggggtgctgagcccagcagccctgcctttgagcagctg
agtcgaggccagaccccctttgctgggacacaggacaagagcagccttgtggggttgccc
ccaagcaagctgagtggccccatcctggggccagggtccttccctagcgatgaccgactc
tcccggccacctccaccagccacgccttcctctatggatgtgaacagccggcaactggta
ggaggctcccaagctttctatcagcgagcaccctatcctgggtccctgcccttacagcag
caacagcaacaactgtggcagcaacaacaggcaacagcagcaacctccatgcgatttgcc
atgtcagctcgctttccatcaactcctggacctgaacttggccgccaagccctaggttcc
ccgttggcgggaatttccacccgtctgccaggccctggtgagccagtgcctggtccagct
ggtcctgcccagttcattgagctgcggcacaatgtacagaaaggactgggacctgggggc
actccgtttcctggtcagggcccacctcagagaccccgtttttaccctgtaagtgaggac
ccccaccgactggctcctgaaggacttcggggcctggcggtatcaggtcttcccccacag
aaaccctcagccccaccggcccctgaattgaacaacagtcttcatccaacaccccacacc
aagggtcctaccctgccaactggtttggagctggtcaaccggcccccgtcgagcactgag
cttggccgccccactcctctggccctggaagctgggaagttgccctgtgaggatcccgag
ctggatgacgattttgatgcccacaaggccctagaggatgatgaagagcttgctcacctg
ggtctgggtgtggatgtggccaagggtgatgatgaacttggcaccttagaaaacctggag
accaatgacccccacttggatgacctgctcaatggagacgagtttgacctgctggcatat
actgatcctgagctggacactggggacaagaaggatatcttcaatgagcacctgaggctg
gtagaatcggctaatgagaaggctgaacgggaggccctgctgcggggggtggagccagga
cccttgggccctgaggagcgccctccccctgctgctgatgcctctgaaccccgcctggca
tctgtgctccctgaggtgaagcccaaggtggaggagggtggacgccacccttctccttgc
caattcaccattgctacccccaaggtagagcccgcacctgctgccaattcccttggcctg
gggctaaagccaggacagagcatgatgggcagccgggatacccggatgggcacagggcca
ttttctagcagtgggcacacagctgagaaggcctcctttggggccacaggaggaccacca
gctcacctgctgacccccagcccactgagtggcccaggaggatcctccctgctggaaaag
tttgagctcgagagtggggctttgaccttgcctggtggacctgcagcatctggggatgag
ctagacaagatggagagctcactggtagccagcgagttacccctgctcattgaggacctg
ttggagcatgagaagaaggagctgcagaagaagcaacagctttcagcacagttgcagcct
gcccagcagcagcagcaacagcagcagcagcattccctactgtctgcaccaggccctgcc
caggccatatctttgccacatgagggctcttctcccagtttggctgggtcccaacagcag
ctttccctgggtcttgcaggtgcccgacagccaggcttgccccaaccactgatgcccacc
cagccaccagctcatgccctccagcaacgcctggctccatccatggctatggtgtccaat
caagggcatatgctaagtgggcagcatggagggcaggcaggcttggtaccccagcagagc
tcacagccagtgctatcacagaagcccatgggcaccatgccaccttccatgtgcatgaag
ccgcagcaactggcaatgcagcagcagctggcaaacagcttcttcccagatacagacctg
gacaaatttgctgcagaagatatcattgatcccattgcaaaggccaagatggtggctttg
aaaggcatcaagaaagtgatggctcagggcagcattggggtggcacctggtatgaacaga
cagcaagtgtctctgctagcccagaggctctcggggggacctggcagtgatctgcagaac
catgtggcagctgggagtggccaggagcggagtgctggtgatccctcccagcctcgtccc
aacccgcccacttttgctcagggagtgatcaatgaagctgaccagcggcagtatgaggag
tggctgttccatacccagcagctcctacagatgcagctgaaggtgctagaggagcagatt
ggcgtacaccgcaagtcccggaaggctctgtgtgccaagcagcgcactgccaaaaaagct
ggccgtgagttcccagaagctgatgctgagaagctcaagctggttacagagcagcagagc
aagatccagaaacaactggatcaggtccggaaacagcagaaggagcacactaatctcatg
gcagaatatcggaacaagcagcagcaacaacagcagcagcagcagcagcagcagcaacag
caacaacactcagctgtgctggctctcagcccttcccagagtccccggctgctcaccaag
ctccctggtcagctgctccctggccatgggctgcagccaccacaggggcctccgggtggg
caagccggaggtcttcgcctgccccctgggggtatggccctacctggacagcctggtggc
cccttccttaatacagctctggcccaacagcagcaacagcaacattctggtggggctgga
tccctggctggcacttcagggggcttcttccctggcaaccttgctcttcgaagcctcgga
cctgattcaaggcttttacaggaaaggcagctgcagctgcagcagcaacgtatgcagctg
gcccagaaactgcagcagcagcagcagcagcagcagcaacagcagcagcagcaccttcta
ggacaggtggcaatccagcagcaacagcagcagggtcctggagtacagacaaaccaagct
ctgggtcccaagccccagggccttatgcctcccagcagccaccaaggcctcctggtccag
cagctgtcccctcaaccaccccaggggccccagggcatgctgggccctgcccaggtggct
gtgttgcagcagcagcaccctggagctttgggcccccagggccctcacagacaggtgctt
atgacccagtcccgggtgctcagttccccccagctggcacagcagggtcagggccttatg
ggacacaggctggtcacagcccagcagcagcagcagcaacaacagcaccaacagcaaggg
tccatggcagggctgtcccatcttcagcagagtctgatgtcacacagtgggcagcccaaa
ctgagcgctcagcccatgggctctttacagcagcttcagcagcagcagcagctgcaacag
caacagcaacttcagcagcagcagcagcagcagctacaacagcaacagcaacttcagcag
caacagcttcaacagcagcaacagcagcagcagctgcaacagcaacagcagcagcagctt
caacagcagcaacagcagctacaacagcaacagcaacaacaacagcagcagtttcaacag
cagcagcaacagcagcagatgggccttttaaaccagagtcgaactttactgtctcctcag
caacaacagcagcagcaagtggcacttggccctggcatgccagcaaagcctcttcaacac
ttttctagccctggagccctgggtccaaccctcctcctgacgggcaaggaacaaaacacc
gtagacccagccgtttcttcagaggccactgaggggccctctacacatcagggagggccg
ttagcaataggaactacccctgagtcaatggccactgaaccaggagaggtaaagccctca
ctctctggggactcacaactcctgcttgtccaaccccagccccagcctcagcccagctct
ctgcagctgcagccacctctgaggcttccaggacaacagcagcagcaagttagcctgctc
cacacagcaggtggaggaagccatgggcagctaggcagtggatcatcttctgaggcctca
tctgtgccccacctgctggctcagccctctgtttccttaggggatcagcctgggtccatg
acccagaaccttctgggcccccaacagcccatgctagagcggcccatgcaaaataataca
gggccacaacctcccaaaccaggacctgtcctccagtctgggcagggtctgcctggggtt
ggaatcatgcctacggtgggtcagcttcgagcacagctccaaggagtcctggccaaaaac
ccacagctgcggcacttaagtcctcagcagcagcagcagctacaggcactcctcatgcag
cggcagctgcagcagagtcaggcagtacgccagaccccaccctaccaggagcctgggacc
cagacctctcccctccagggcctcctgggctgccaacctcaacttgggggcttccctgga
ccacagacaggcccccttcaggagctaggggcagggcctcgacctcagggcccaccccgg
ctccctgccccaccaggagccttatctacaggaccagtccttggccctgtccatcccaca
cctccaccatccagccctcaagagccaaagagaccttcacagttaccttcccccagctcc
cagcttcccactgaggcccagctccctcccacccatccagggacccccaaaccccagggg
ccaaccttggagccgcctcctgggagggtgtcacctgctgctgcccagcttgcagatacc
ttgtttagcaagggtctgggaccttgggatcccccagacaacctagcagaaacccagaag
ccagagcagagcagcctggtacctgggcatctggaccaggtgaatggacaggtggtgcct
gaggcatcccaactcagcatcaagcaggaacctcgggaagagccatgtgccctgggagcc
cagtcagtgaagagggaggccaatggggagccaataggggcaccaggaaccagcaaccac
ctcctgctggcaggccctcgctcagaagctgggcatctgctcttgcagaagctactccgg
gcaaagaatgtgcaactcagcactgggcgggggtccgaggggctgcgagctgagatcaac
gggcacattgacagcaagctggctgggctggagcagaaactacagggtacccccagcaac
aaggaggatgcagcagcaaggaagcctttgacaccgaagcccaagcgggtacagaaggca
agcgacaggttggtgagctcccgaaagaagctgcggaaggaggacggggtcagggccagc
gaggccttgctgaaacagctgaaacaggagctgtccctgctgcccctaacggagcctgct
atcaccaccaattttagcctctttgccccctttggcagtggctgcccagtcaatgggcag
agccagctgaggggggcctttggaagtggggcgctgcccactggccctgactactattcc
cagctgcttaccaagaataacctgagtaacccgccgacaccaccctcgtcgctgcccccc
accccacccccatcggtgcagcagaagatggtgaatggcgtcaccccatctgaagagctg
ggggagcaccccaaggatgctgcctctgcccgggatagtgaaagggcactgagggatact
tcagaggtgaagagtctagacctgctggctgccttgcctacaccccctcacaatcagact
gaggatgtcaggatggagagtgatgaggatagcgattctcctgacagcattgtgccagct
tcatcccctgagagcatcttgggggaggagacccctcgtttccctcatctgggctcaggc
cggtgggagcaagaggaccgggccctctcccctgtcatccccctcattcctcgggccagc
atcccagtcttcccagataccaaaccttatggggcccttgacctggaggtccctggaaag
ctgcctgtcacaacttgggaaaagggcaaaggaagtgaggtgtcagtcatgctcacagtc
tctgctgctgcagccaagaacctgaatggcgtgatggtggcagtggcggagctgctgagc
atgaagatccccaactcctatgaggtgctgttcccagagagccccgcccgggcaggcact
gagccaaagaagggggaagctgagggtcctggtgggaaggaaaagggtctgggaggcaag
agcccagacactggccctgattggctgaagcagtttgatgcagtgttgcctggctatacc
ctgaagagccaactagacatcttgagcctcctgaaacaggagagccccgccccagagcca
cccactcagcacagctatacctacaatgtctccaatctggatgtgcgacagctctcggcc
ccacctcctgaagaaccctccccgcccccttcccccttggcaccttctcctgccagtccc
cctactgagcccttggttgaacttcccaccgaacccttggctgagccacccgtcccctca
cctctgccactggcctcatcccctgaatcagcccgacccaagccccgtgcccggccccct
gaagaaggtgaagattcccgtcctcctcgcctcaagaaatggaaaggagtgcgctggaag
cggcttcggctgctgctgaccatccagaagggcagtgggcggcaggaggatgagcgggaa
gtggcagagtttatggagcagcttggcacagccttgcgacctgacaaggtaccgcgagac
atgcgtcgctgctgtttctgtcatgaggagggtgacggggccactgatgggcctgcccgt
ctgctgaacctggacctggacctgtgggtgcacctcaactgtgccctttggtccacggag
gtgtatgagacccagggcggggcactgatgaatgtggaggttgccctgcaccgaggactg
ctaaccaagtgctccctgtgccagcgaactggtgccaccagcagctgcaatcgcatgcgt
tgccccaatgtctaccattttgcttgtgccatccgtgccaagtgcatgttcttcaaggac
aagaccatgctgtgtccaatgcataagatcaaggggccctgtgagcaagagctgagctct
tttgctgtcttccggcgggtctacattgagcgggacgaggtgaagcaaatcgctagcatc
attcagcggggagaacggctgcacatgttccgtgtggggggccttgtgttccacgccatc
ggacagctgctgcctcaccagatggctgactttcatagtgccactgccctctatcccgtg
ggctacgaggccacgcgcatctattggagcctccgcaccaacaatcgtcgctgttgctat
cgctgttctattggtgagaacaacgggcggccggagtttgtaatcaaagtcatcgagcag
ggcctggaggacctggtcttcactgacgcctctccccaggccgtgtggaatcgcatcatt
gagcctgtggctgccatgagaaaagaggctgacatgctgcgactcttccctgagtatctg
aagggcgaggagctctttgggctgacggtgcatgccgtgcttcgcatagctgaatcactg
cccggggtggagagctgtcaaaactatttattccgctatgggcgccacccccttatggag
ctgccactcatgatcaaccccactggctgtgcccgatcagagcctaaaatcctcacacac
tacaaacggccccataccctgaacagcaccagcatgtctaaggcatatcagagcaccttc
acaggcgagaccaacaccccctacagcaagcagtttgtgcactccaagtcatctcagtac
cggcggctgcgcaccgaatggaagaacaacgtgtacctggctcgctcccgtatccagggc
ctggggctctatgcagccaaggacctagaaaagcacacaatggttatcgagtacattggc
accatcattcggaacgaggtggccaaccggcgggagaaaatctacgaagagcagaatcga
ggcatctacatgttccgaataaacaatgaacatgtgattgatgctacgttgaccggcggc
cctgccaggtacattaaccattcctgtgcccctaactgtgtggctgaagtcgtgacattt
gacaaagaggacaaaatcatcatcatctccagccggcgaatccccaaaggagaggagcta
acctatgactatcagtttgattttgaggacgatcagcacaagatcccctgccactgtgga
gcctggaattgtcggaaatggatgaactaa

DBGET integrated database retrieval system