KEGG   Pan paniscus (bonobo): 100995906Help
Entry
100995906         CDS       T02283                                 

Gene name
LAMC3
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
pps  Pan paniscus (bonobo)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pps00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100995906 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100995906 (LAMC3)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100995906 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100995906 (LAMC3)
   05222 Small cell lung cancer
    100995906 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    100995906 (LAMC3)
   05145 Toxoplasmosis
    100995906 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1554 aa AA seqDB search
MGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPEDFCPHVGAAGAGAQCQRCDAAD
PQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNITLRLGKAYEITYVRLKFHTSR
PESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLRPGEDERVAFCTSEFSDISPLS
GGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDRLNTFGDDIFKDPKVLQSYYYA
VSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTDCERCLPFFQDRPWARGTAEAA
HECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTAGPHCERCQENFYHWDPRMPCQ
PCDCHSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFHSLSEGGCRPCTCNPAGSLDTC
DPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCSSCFCYGHSKVCAATAQFQVHHIL
TDFHQGAEGWWARSVGGSEHPPQWSPNGVLLSPEDEEELTAPEKFLGDQRFSYGQPLILT
FRVPPGDSPLPVQLRLEGAGLALSLRHSSLSGPQDAGHPREVELRFHLQETSEDVAPPLP
PFHFQRLLANLTSLRLHVSPGPSPAGPVFLTEVRLTSARPGLSPPASWVETCSCPSGYTG
QFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPNTGICVCSHHTEGPSCERCLPGFY
GNPFAGQADDCQPCPCPGQSACTTIPESGEVVCTHCPPGQRGRRCEVCDDGFFGDPLGLF
GHPQPCHQCQCSGNVDPNAMGNCDPLSGHCLRCLHNTTGDHCEHCQEGFYGSALAPRPAD
KCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTARDCSRCYPGFFDLQPGRGCRSCKCHP
LGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFSIKGCRACRCSPLGAASAQCHENG
TCVCRPGFEGYKCDRCHDNFFLTADGTHCQECPSCYALVKEEAAKLKARLTLTEGWLQGS
NCGSPWGPLDILLGEAPRGDVYQGHHLLPGAREAFLEQMMGLEGAVKAAREQLQRLNKGA
RCAQAGSQKTCTQLADLEAVLESSEEEILHAAAILASLEILQEGPSQPTKWSHLATEARA
LARSHRDTATKIAATAWRALLASNTSYVLLWNLLEGRVALETQRDLEDRYQEVQAAHKAL
RTAVAEVLPEAESVLATVQQVGADTAPYLALLASPGALPQKSRAEDLGLKAKALEKTVAS
WQHMATEAARTLQTAAQATLRQTEPLTKLHQEARGALTQASSSVQAATVTVMGARTLLAD
LEGMKLQFPRPKDQAALQRKADSVSDRLLADTRKKTKQVERMLGNAAPLSSSAKKKGREA
EVLAKDSAKLAKALLRERKQAHRRASRLTSQTQATLQQASQQVLASEARRQELEEAERVG
AGLSEMEQQIRESRISLEKDIETLSELLARLGSLDTHQAPAQALNETQWALERLRLQLGS
PGSLQRKLSLLEQESQQQELQIQGFESDLAEIRADKQNLEAILHSLPENCASWQ
NT seq 4665 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgtgctatgacggcgcagggcgcccgcagcgctgcctgccggtgttcgagaac
gcggcgtttgggcggctcgcccaggcctcgcacacgtgcggcagcccgcccgaggacttc
tgtccccacgtgggcgccgcgggcgcgggggctcagtgccagcgctgcgacgccgccgac
ccccagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgagagcacc
tggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtcaacatcacc
ctccgcctagggaaggcttacgagatcacgtatgtgaggctgaagttccacaccagtcgc
cctgagagcttcgccatctacaagcgcagccgcgccgacggcccgtgggagccctaccag
ttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgcccc
ggcgaggacgagcgcgtggccttctgcacctctgagttcagcgacatctccccgctgagt
ggcggcaacgtggccttctccaccctggagggccggcccagcgcctacaactttgaggag
agccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccggctc
aacacgtttggggacgacatcttcaaggaccccaaggtgctccagtcctactattatgcc
gtgtccgacttctctgtgggcggcaggtgcaagtgcaacgggcatgccagcgagtgcggc
cccgacgtggcgggccagttggcctgccggtgccagcacaacaccaccggcacagactgt
gagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcaccgccgaggctgcc
cacgagtgtctgccctgcaactgcagtggccgctctgaggaatgcacgtttgatcgggag
ctcttccgcagcacaggccacggcgggcgctgtcaccactgccgtgaccacacagctggg
ccgcactgtgagcgctgtcaggagaatttctatcactgggacccgcggatgccatgccag
ccctgtgactgccactcggcaggctccctacacctccagtgcgatgacacaggcacctgc
gcctgcaagcccactgtgactggctggaagtgtgaccgctgtctgcccgggttccactcg
ctcagtgagggaggctgcagaccctgcacttgcaatcccgctggcagcctggacacctgt
gacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaacctatgtgacaga
tgtcgcccggggacctttaacctgcagccccacaatccagctggctgcagcagctgtttc
tgctatggccactccaaggtgtgcgcggccactgcccagttccaggtgcatcacatcctc
accgatttccaccagggagccgaaggctggtgggccagaagtgtggggggctctgagcac
cccccacaatggagcccaaatggggtcctcctgagcccagaagacgaggaggagctcaca
gcaccagagaagttcctgggagaccagcggttcagctatgggcagccccttatactgacc
ttccgggtgccccccggggactccccactccctgtgcagctgaggctggaaggggcaggc
ttggccctgtccctgaggcactctagcctgtctggcccccaggatgccgggcatcccagg
gaggtagagctcaggttccacctgcaggagacctccgaggacgtggcccctccactgccc
cccttccacttccagcggctcctcgccaacctgaccagcctccgcctccacgtcagtccc
ggccccagccctgccggtccagtgttcctgactgaggtccggctcacatccgcccggcca
gggctttccccgccagcctcctgggtggagacttgttcatgtcccagtggctacacgggc
cagttctgtgaatcctgtgctccgggatacaagagggagatgccacaggggggtccctat
gccagctgtgtcccctgcacctgtaaccagcatggcacctgtgaccccaacacagggatc
tgtgtctgcagccaccataccgagggcccatcctgtgaacgctgtttgccaggtttctat
ggcaaccctttcgcgggccaagccgacgactgccagccctgtccctgccctggccagtcg
gcctgtacgaccatcccagagagcggggaggtggtgtgcacccactgccccccgggccag
agagggcggcgctgtgaggtctgtgatgatggcttttttggggacccgctggggctcttt
gggcacccccagccctgccaccagtgccagtgtagcgggaacgtggaccccaatgccatg
ggcaactgtgaccccctgtctggccactgcctgcgctgcctgcacaacaccacgggtgac
cactgtgagcactgtcaggaaggcttctacgggagcgccctggcccctcgacccgcagac
aaatgcatgccttgcagctgtcacccacagggctcggtcagtgagcagatgccctgcgac
ccagtgacaggccaatgctcctgcctgcctcatgtgactgcacgggactgcagccgctgc
taccctggcttcttcgacctccagcctgggaggggctgccggagctgcaagtgtcaccca
ctgggctcccaggaggaccagtgccatcccaagactggacagtgcacctgccgcccaggt
gtcacaggccaggcctgtgacagatgccagctgggtttcttcggcttctccatcaagggc
tgccgggcctgcaggtgctccccactgggcgctgcctcggcccagtgccatgagaacggc
acatgcgtgtgcaggcctggcttcgagggctacaaatgtgaccgctgccacgacaacttc
ttcctcacggcagacggcacacactgccaggaatgtccatcctgctacgccctggtgaag
gaggaggcagccaagctgaaggccagactgactttgacggaggggtggctgcaagggtcc
aactgtggcagtccctggggaccactagacattctgctgggagaggccccaaggggggac
gtctaccagggccatcacctgcttccaggggctcgggaagccttcctggagcagatgatg
ggcctcgagggtgctgtgaaggccgcccgggagcagctgcagaggctgaacaagggtgcc
cgctgtgcccaggccggatcccagaagacctgcacccagctggcagacctggaggcagtg
ctggagtcctcggaagaggagattctgcatgcagctgccattctcgcgtctctggagatt
cttcaggaaggtcccagtcagccgaccaaatggagccacctggccacagaggcccgtgcc
ctcgccaggagccacagagacaccgccaccaagatcgcagccactgcttggagggccctg
ctcgcctccaacaccagctacgtgcttctctggaatctgctggagggaagggtggcccta
gagacccagcgggacctggaggacaggtaccaggaggtccaggcggcccacaaagcactg
aggacggctgtggcagaggtgctgcctgaagcggaaagcgtgttggccaccgtgcagcaa
gttggcgcagatacagccccgtacctggccttgctggcttccccgggagctctgcctcag
aagtcccgggctgaagacctgggcctgaaggcaaaggccctggagaagacagttgcatca
tggcagcacatggccactgaggctgcccgaaccctccagactgctgcccaggcgacgcta
cggcaaacagaacccctcacaaagctgcaccaggaggccagaggcgccctgacccaggct
tcctcatctgtccaggctgcgacagtgactgtcatgggagccaggactctgctggctgac
ctggaaggaatgaagctgcagtttccccggcccaaggaccaggcggcattgcagaggaag
gcagactccgtcagtgacagactccttgcagacacgagaaagaagaccaagcaggtggag
aggatgctgggaaacgcggcccctctttcctccagtgccaagaagaagggcagagaagca
gaggtgttggccaaggacagtgccaagcttgccaaggccttgctgagggagcggaaacag
gcgcaccgccgtgccagccggctcaccagccagacgcaagccacgctccaacaggcgtcc
cagcaggtgctggcgtctgaagcacgcagacaggagctggaggaagctgagcgggtgggt
gctgggctgagcgagatggagcagcagatccgggaatcacgtatctcactggagaaggac
atcgagaccttgtcagagctgcttgccaggctggggtcgctggacacccatcaagcccca
gcccaggccctgaacgagactcagtgggcactagaacgcctgaggctgcagctgggctcc
ccggggtccttgcagaggaaactcagtctgctggagcaggaatcccagcagcaggagctg
cagatccagggctttgagagtgacctcgccgagatccgcgccgacaaacagaacctggag
gccattctgcacagcctgcccgagaactgtgccagctggcagtga

DBGET integrated database retrieval system