KEGG   Pan paniscus (bonobo): 100996034Help
Entry
100996034         CDS       T02283                                 

Definition
cytochrome P450 2C9
Orthology
K17719  
cytochrome P450, family 2, subfamily C, polypeptide 9 [EC:1.14.13.48 1.14.13.49 1.14.13.80 1.14.13.-]
Organism
pps  Pan paniscus (bonobo)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Serotonergic synapse
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:pps00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100996034
   00591 Linoleic acid metabolism
    100996034
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100996034
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100996034
   00982 Drug metabolism - cytochrome P450
    100996034
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    100996034
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100996034
Enzymes [BR:pps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.48  (S)-limonene 6-monooxygenase
     100996034
    1.14.13.49  (S)-limonene 7-monooxygenase
     100996034
    1.14.13.80  (R)-limonene 6-monooxygenase
     100996034
    1.14.13.-  
     100996034
Cytochrome P450 [BR:pps00199]
 Cytochrome P450, animal type
  CYP2 family
   100996034
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 490 aa AA seqDB search
MDSLVVLVLCLSCLLLLSLWRQSSGRGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKV
YGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAERANRGFGIVFSNGKKW
KEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICS
IIFHKRFDYKDQQFLNLMEKLNENVKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFM
KSYILEKVKEHQESMDMNNPQDFIDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTE
TTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRSHMPYTDAVVHEVQRYID
LLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK
KSNYFMPFSAGKRICVGEALARMELFLFLTSILQNFNLKSLVDPKNLDTTPVVNGFASVP
PFYQLCFIPV
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggattctcttgtggtccttgtgctctgtctctcatgtttgcttctcctttcactctgg
agacagagctctgggagaggaaaactccctcctggccccactcctctcccagtgattgga
aatatcctacagataggtattaaggacatcagcaaatccttaaccaatctctcaaaggtc
tatggccctgtgttcactctgtattttggcctgaaacccatagtggtgctgcatggatat
gaagcagtgaaggaagccctgattgatcttggagaggagttttctggaagaggcattttc
ccactggctgaaagagctaacagaggatttggaattgttttcagcaatggaaagaaatgg
aaggagatccggcgtttctccctcatgacgctgcggaattttgggatggggaagaggagc
attgaggaccgtgttcaagaggaagcccgctgccttgtggaggagttgagaaaaaccaag
gcctcaccctgtgatcccactttcatcctgggctgtgctccctgcaatgtgatctgctcc
attattttccataaacgttttgattataaagatcagcaatttcttaacttgatggaaaag
ttgaatgaaaacgtcaagattttgagcagcccctggatccagatctgcaataatttttct
cctatcattgattacttcccgggaactcacaacaaattacttaaaaacgttgcttttatg
aaaagttatattttggagaaagtaaaagaacaccaagaatcgatggacatgaacaaccct
caggactttattgattgcttcctgatgaaaatggagaaggaaaagcacaaccaaccatct
gaatttactattgaaagcttggaaaacactgcagttgacttgtttggagctgggacagag
acgacaagcacaaccctgagatatgctctccttctcctgctgaagcacccagaggtcaca
gctaaagtccaggaagagattgaacgtgtgattggcagaaaccggagcccctgcatgcag
gacaggagccacatgccctacacagatgctgtggtgcacgaggtccagagatacattgac
cttctccccaccagcctgccccatgcagtgacctgtgacattaaattcagaaactatctc
attcccaagggcacaaccatattaatttccctgacttctgtgctacatgacaacaaagaa
tttcccaacccagagatgtttgaccctcatcactttctggatgaaggtggcaattttaag
aaaagtaactacttcatgcctttctcagcaggaaaacggatttgtgtgggagaagccctg
gcccgcatggagctgtttttatttctgacctccattttacagaactttaacctgaaatct
ctggttgacccaaagaaccttgacaccactccagttgtcaatggatttgcctctgtgccg
cccttctaccagctgtgcttcattcctgtctga

DBGET integrated database retrieval system