KEGG   Pseudomonas putida S16: PPS_0044Help
Entry
PPS_0044          CDS       T01570                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppt  Pseudomonas putida S16
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPS_0044
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPS_0044
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPS_0044
Enzymes [BR:ppt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPS_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(47784..48593)
Genome map
AA seq 269 aa AA seqDB search
MSRLEKRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVEKFVAEAKQ
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAAIARLSDGVVVGSALVDKI
AQAKSAEQAVNDVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaaaaacgcttcgccgagctgaaggccgaaggccgctcggcactggtc
acctttgtcaccgcgggcgacccgggctatgacgcctcgctgcagatcctcaagggcctg
ccggcagccggtgccgacgtgattgaactgggcatgccgttcaccgacccgatggccgac
ggcgtggccatccagctggccaccctgcgtgccctggaagccggccagaccctggccaag
accctgcagatggttcgcgaattccgtgtggataaccagaccacaccgatcgtgttgatg
ggctactacaacccgatccaccgctttggcgtggaaaagttcgtggccgaagccaagcaa
gcgggtgtagatggcctgatcatcgtcgacctgccgccagagcacgacgccgaactggca
accccggcccaggcagcgggtatcgactttatccgcctgactaccccaaccaccgacgac
gcgcgcctgccgcgcgtactggagcgcagctccgggttcgtctactacgtgtcggtggcc
ggtgtgaccggcgccggctcggcgaccaccgagcacgtgaccgaagccatcgcccgcctg
cgtcggcataccgatctgccaatcagcgtaggtttcggcattcgtacgccggagcaggct
gcggccattgcccgcctgtcggacggcgtagtggtgggctcggcgctggtcgacaagatt
gcccaggccaagagtgccgagcaggcagtcaacgatgtattgagcctgtgctcggcgctg
gctgaaggggtgcgcggcgcccgccgctga

DBGET integrated database retrieval system