KEGG   Pseudomonas putida S16: PPS_0044Help
Entry
PPS_0044          CDS       T01570                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00260  Glycine, serine and threonine metabolism
ppt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01130  Biosynthesis of antibiotics
ppt01230  Biosynthesis of amino acids
Module
ppt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPS_0044
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPS_0044
Enzymes [BR:ppt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPS_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB PEP_mutase ThiG KDGP_aldolase PA Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AEJ10633
UniProt: F8FU83
Position
complement(47784..48593)
Genome map
AA seq 269 aa AA seqDB search
MSRLEKRFAELKAEGRSALVTFVTAGDPGYDASLQILKGLPAAGADVIELGMPFTDPMAD
GVAIQLATLRALEAGQTLAKTLQMVREFRVDNQTTPIVLMGYYNPIHRFGVEKFVAEAKQ
AGVDGLIIVDLPPEHDAELATPAQAAGIDFIRLTTPTTDDARLPRVLERSSGFVYYVSVA
GVTGAGSATTEHVTEAIARLRRHTDLPISVGFGIRTPEQAAAIARLSDGVVVGSALVDKI
AQAKSAEQAVNDVLSLCSALAEGVRGARR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtcttgaaaaacgcttcgccgagctgaaggccgaaggccgctcggcactggtc
acctttgtcaccgcgggcgacccgggctatgacgcctcgctgcagatcctcaagggcctg
ccggcagccggtgccgacgtgattgaactgggcatgccgttcaccgacccgatggccgac
ggcgtggccatccagctggccaccctgcgtgccctggaagccggccagaccctggccaag
accctgcagatggttcgcgaattccgtgtggataaccagaccacaccgatcgtgttgatg
ggctactacaacccgatccaccgctttggcgtggaaaagttcgtggccgaagccaagcaa
gcgggtgtagatggcctgatcatcgtcgacctgccgccagagcacgacgccgaactggca
accccggcccaggcagcgggtatcgactttatccgcctgactaccccaaccaccgacgac
gcgcgcctgccgcgcgtactggagcgcagctccgggttcgtctactacgtgtcggtggcc
ggtgtgaccggcgccggctcggcgaccaccgagcacgtgaccgaagccatcgcccgcctg
cgtcggcataccgatctgccaatcagcgtaggtttcggcattcgtacgccggagcaggct
gcggccattgcccgcctgtcggacggcgtagtggtgggctcggcgctggtcgacaagatt
gcccaggccaagagtgccgagcaggcagtcaacgatgtattgagcctgtgctcggcgctg
gctgaaggggtgcgcggcgcccgccgctga

DBGET integrated database retrieval system