KEGG   Pseudomonas putida S16: PPS_0045Help
Entry
PPS_0045          CDS       T01570                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ppt  Pseudomonas putida S16
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPS_0045
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPS_0045
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPS_0045
Enzymes [BR:ppt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PPS_0045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(48590..49807)
Genome map
AA seq 405 aa AA seqDB search
MTQSQYRPGPDANGLFGSFGGRYVAETLMPLVLDLAREYEAAKADPKFLEELAYFQRDYI
GRPNPLYFAERLTEHCGGAKIFFKREELNHTGAHKVNNCIGQVLLAKRMGKKRLIAETGA
GMHGVATATVAARFGLPCVIYMGATDIERQQANVFRMKLLGAEIVPVTAGTGTLKDAMNE
ALRDWVTNVEDTFYLIGTVAGPHPYPAMVRDFQSIIGKETRAQLQEKEGRLPDSLVACVG
GGSNAMGLFHEFLEEPSVQIIGVEAGGHGVHTDKHAASLNGGIPGVLHGNRTYLLQDEDG
QITDAHSISAGLDYPGIGPEHAYLHEVKRVEYVSITDDEALDAFHATCRLEGIIPALESS
HALAEAIKRAPKLPKDHLMVVCLSGRGDKDMQTVMNHMAAQEKQA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtcccaataccgccccggccccgacgccaatggcctgttcggctcgttcggc
ggccgctacgtggccgaaaccctgatgccactggtgctggacctggcccgcgaatacgaa
gcggccaaggcagaccccaagttcctcgaagagctggcctacttccagcgcgactacatc
gggcgccccaacccgctgtacttcgccgagcgcctgaccgagcactgcggcggcgccaag
atcttcttcaagcgtgaagagctcaaccacaccggcgcgcacaaggtgaacaactgcatc
ggccaggtgctgctggccaagcgcatgggcaagaagcgcctcatcgcagaaaccggcgcc
ggcatgcacggcgtggccaccgccaccgtcgctgcccgcttcggcctgccttgcgtaatc
tacatgggcgccaccgacatcgagcgccagcaggccaacgtgttccgcatgaagctgctt
ggcgccgaaatcgtcccggtcactgccggcaccggcaccctgaaggacgccatgaacgag
gctctgcgcgactgggtcaccaacgtcgaagacaccttctacctgatcggcaccgtggct
ggcccgcacccgtatccggccatggtccgcgacttccagtcgatcatcggcaaggaaacc
cgcgcccagttgcaagagaaggaaggccgcctgccagacagcctggttgcctgcgtcggt
ggtggctccaacgccatgggcctgttccatgagtttctcgaagagccaagcgtgcagatc
atcggcgtcgaagccggtggccacggcgtgcacaccgacaagcacgccgccagcctgaac
ggcggcataccgggcgtgctgcacggcaaccgcacctacctgctgcaggacgaagacggt
cagatcaccgacgcccactcgatttccgccggcctggactacccgggcatcggcccggag
cacgcctacctgcacgaagtgaagcgtgtcgagtacgtcagcatcaccgacgacgaagcg
ctggatgcattccatgccacctgccgcctggaaggcatcatcccggccctggaaagctcc
cacgccttggccgaggcgatcaagcgcgcaccgaagctgcccaaggaccacctgatggtc
gtgtgcctgtcgggccgcggcgacaaagacatgcaaaccgtcatgaaccacatggccgcc
caggagaaacaggcatga

DBGET integrated database retrieval system