KEGG   Pseudomonas putida S16: PPS_0094Help
Entry
PPS_0094          CDS       T01570                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
ppt  Pseudomonas putida S16
Brite
Enzymes [BR:ppt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PPS_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
93740..95683
Genome map
AA seq 647 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDQCMKEMRE
VIRSDNMDAGLAGLIPRLEKAVLDSEQRREARMNQVSDALTALVDQLQGLPLPNDVSRPL
KKLAKKLDGGVAHSRDLPPLLGELSGLQGRALSALGKSAAEARPGFLQRLFGGREDGVQG
EPALVPLALPVVEAQPLAAPAGVDAPQPDDMDALQPLPASSASVVEALVISEPELEAPGP
ALIETAELSPAPLPQPLPDDVPAPVAIASEPPVETGPAQTLEETFGEDGPYALPYAVEPP
YSQVAEHIEHTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAIT
DSGQHEFETYLQQLNERLEGFQSHLHEASAGHADNSSAARELDSQLREHVDGLQSSVQGA
ADVDSLKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLSERVANMEQEALGYREHL
EEQRQKALLDPLTGLPNRAAWSERVEREMLEWQAHGGHLAMAILDLDHFKRINDSYGHLA
GDKVLKIVADQLRKRLRGHDFIARFGGEEFVLLLPQTSPAAAAQIAEVLRATVEACPFHF
KGERVVITTSIGLGAFRPGERGDQVLKRADAALYRAKESGRNRIELA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaatacctgaaaagcatcgagcagcaggaa
aagctcgagcgccgttgggacgcccgtctcgacctgctgcgtcgtggtttggtacgcagc
accctggctgctgaaggcagcgacaaggtggtagaccagtgcatgaaggaaatgcgcgag
gtcatccgcagcgacaacatggacgccggccttgccgggttgattcctcgtcttgagaag
gcggtactggactccgaacagcgtcgggaagcccgcatgaaccaggtcagcgatgcgctg
acagcgctggtcgaccagctgcaaggcctgccattgccgaacgatgtgtcgcgtccgttg
aaaaagctggcgaagaagctcgatggcggagtggcccactcacgcgacctgccaccgttg
ctgggcgagttgagcggcttgcagggccgcgcgctgtcagccttgggcaaatcggcggcg
gaggcccgccccggcttcttgcagcgcttgttcggcggccgcgaggatggcgtacaaggc
gagccagcgcttgtgcctctggcgctgccggttgtcgaggcgcagcctttggcggcacct
gccggtgtcgatgccccgcagcccgacgacatggacgcgctacagccgttgccagcctcc
tcagcttctgttgtcgaagccctcgtaatatcggagcccgagctggaggcaccaggcccg
gcgcttatcgaaacggccgaactgtcaccagccccgctgccgcagccgctcccggacgat
gtaccggcaccggtagctatcgccagcgagccgccggttgaaacaggaccggcgcaaaca
ctcgaagaaacctttggcgaagatggtccctacgccctgccctacgcggtggagccgccc
tacagccaggttgccgagcacatcgagcacactctgatcggcttgctcgatgacctcagc
ctgccggagcgacacaaggcccaggcgctagagatgcgtgaacgcgtcgcccggggcttg
aactggtatgagctgataccggtgctggatgacctggctgtgctcatgctggcgatcacc
gacagcggccagcacgaattcgaaacctacctgcagcagctcaacgaacgcctggaaggt
ttccagagccacctgcacgaggctagcgccggccatgccgacaacagctcggccgctcgc
gagctggatagccagctgcgtgagcacgtcgatgggttgcagagcagtgtgcaaggtgcc
gccgacgtcgacagcctcaagcatattctggaaaaccgcctggaaggtctgttggtgacc
atggatgagcacaagcatgagcgtgatcgccgcgaacaggagctggctggacgcctgcaa
gggctgtcggagcgggtggcgaacatggagcaagaggcgctcggctaccgtgagcacttg
gaagagcagcgccagaaggccttgcttgatcccctaaccggcctgcccaaccgtgcagcc
tggagcgagcgggtcgagcgcgaaatgctcgaatggcaggcacacggcggccatctggcg
atggcgatcctcgacctggaccatttcaagcgtatcaacgacagctatgggcacctggct
ggggacaaggtcttgaagatcgtcgccgaccagttgcgcaagcgcctgcgcggccatgac
ttcatcgcccggtttggcggcgaggagtttgtcctgctgctgccgcagacctcgccggct
gccgctgcccagatagccgaggtgctgagggccacggtcgaggcgtgcccgttccacttc
aagggcgaacgggtggtgatcaccacgtccatcggcctgggtgcattccgtcccggcgag
cgcggcgatcaggtgctcaagcgcgccgatgcggcgctttaccgggccaaggaatcggga
cgcaaccgtatcgagctggcatag

DBGET integrated database retrieval system