KEGG   Pseudomonas putida S16: PPS_0094Help
Entry
PPS_0094          CDS       T01570                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
ppt  Pseudomonas putida S16
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
93740..95683
Genome map
AA seq 647 aa AA seqDB search
MTEDAERWKEKYLKSIEQQEKLERRWDARLDLLRRGLVRSTLAAEGSDKVVDQCMKEMRE
VIRSDNMDAGLAGLIPRLEKAVLDSEQRREARMNQVSDALTALVDQLQGLPLPNDVSRPL
KKLAKKLDGGVAHSRDLPPLLGELSGLQGRALSALGKSAAEARPGFLQRLFGGREDGVQG
EPALVPLALPVVEAQPLAAPAGVDAPQPDDMDALQPLPASSASVVEALVISEPELEAPGP
ALIETAELSPAPLPQPLPDDVPAPVAIASEPPVETGPAQTLEETFGEDGPYALPYAVEPP
YSQVAEHIEHTLIGLLDDLSLPERHKAQALEMRERVARGLNWYELIPVLDDLAVLMLAIT
DSGQHEFETYLQQLNERLEGFQSHLHEASAGHADNSSAARELDSQLREHVDGLQSSVQGA
ADVDSLKHILENRLEGLLVTMDEHKHERDRREQELAGRLQGLSERVANMEQEALGYREHL
EEQRQKALLDPLTGLPNRAAWSERVEREMLEWQAHGGHLAMAILDLDHFKRINDSYGHLA
GDKVLKIVADQLRKRLRGHDFIARFGGEEFVLLLPQTSPAAAAQIAEVLRATVEACPFHF
KGERVVITTSIGLGAFRPGERGDQVLKRADAALYRAKESGRNRIELA
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacgctgagcgctggaaagaaaaatacctgaaaagcatcgagcagcaggaa
aagctcgagcgccgttgggacgcccgtctcgacctgctgcgtcgtggtttggtacgcagc
accctggctgctgaaggcagcgacaaggtggtagaccagtgcatgaaggaaatgcgcgag
gtcatccgcagcgacaacatggacgccggccttgccgggttgattcctcgtcttgagaag
gcggtactggactccgaacagcgtcgggaagcccgcatgaaccaggtcagcgatgcgctg
acagcgctggtcgaccagctgcaaggcctgccattgccgaacgatgtgtcgcgtccgttg
aaaaagctggcgaagaagctcgatggcggagtggcccactcacgcgacctgccaccgttg
ctgggcgagttgagcggcttgcagggccgcgcgctgtcagccttgggcaaatcggcggcg
gaggcccgccccggcttcttgcagcgcttgttcggcggccgcgaggatggcgtacaaggc
gagccagcgcttgtgcctctggcgctgccggttgtcgaggcgcagcctttggcggcacct
gccggtgtcgatgccccgcagcccgacgacatggacgcgctacagccgttgccagcctcc
tcagcttctgttgtcgaagccctcgtaatatcggagcccgagctggaggcaccaggcccg
gcgcttatcgaaacggccgaactgtcaccagccccgctgccgcagccgctcccggacgat
gtaccggcaccggtagctatcgccagcgagccgccggttgaaacaggaccggcgcaaaca
ctcgaagaaacctttggcgaagatggtccctacgccctgccctacgcggtggagccgccc
tacagccaggttgccgagcacatcgagcacactctgatcggcttgctcgatgacctcagc
ctgccggagcgacacaaggcccaggcgctagagatgcgtgaacgcgtcgcccggggcttg
aactggtatgagctgataccggtgctggatgacctggctgtgctcatgctggcgatcacc
gacagcggccagcacgaattcgaaacctacctgcagcagctcaacgaacgcctggaaggt
ttccagagccacctgcacgaggctagcgccggccatgccgacaacagctcggccgctcgc
gagctggatagccagctgcgtgagcacgtcgatgggttgcagagcagtgtgcaaggtgcc
gccgacgtcgacagcctcaagcatattctggaaaaccgcctggaaggtctgttggtgacc
atggatgagcacaagcatgagcgtgatcgccgcgaacaggagctggctggacgcctgcaa
gggctgtcggagcgggtggcgaacatggagcaagaggcgctcggctaccgtgagcacttg
gaagagcagcgccagaaggccttgcttgatcccctaaccggcctgcccaaccgtgcagcc
tggagcgagcgggtcgagcgcgaaatgctcgaatggcaggcacacggcggccatctggcg
atggcgatcctcgacctggaccatttcaagcgtatcaacgacagctatgggcacctggct
ggggacaaggtcttgaagatcgtcgccgaccagttgcgcaagcgcctgcgcggccatgac
ttcatcgcccggtttggcggcgaggagtttgtcctgctgctgccgcagacctcgccggct
gccgctgcccagatagccgaggtgctgagggccacggtcgaggcgtgcccgttccacttc
aagggcgaacgggtggtgatcaccacgtccatcggcctgggtgcattccgtcccggcgag
cgcggcgatcaggtgctcaagcgcgccgatgcggcgctttaccgggccaaggaatcggga
cgcaaccgtatcgagctggcatag

DBGET integrated database retrieval system