KEGG   Pseudomonas putida S16: PPS_0161Help
Entry
PPS_0161          CDS       T01570                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ppt  Pseudomonas putida S16
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPS_0161
Enzymes [BR:ppt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     PPS_0161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
192042..192809
Genome map
AA seq 255 aa AA seqDB search
MSQWRLLLTRPAEDCAALAQSLAAAGVGSSCLPLLAIEPVALGDRQRPLLKGLPGFQAII
VVSKPAARLLLEHLAQASLQPPRQGWFTVGEATAAVLQGAGLVVSFPPRGDDSEALLALP
ALRQAVAVPAPRILIVRGVGGRELLAERLAEQGASVDYLELYRRCLPAYPAGTLMRRIEA
ERLNGLVVSSGQGFEHLQQMAGADWPLVARLPLFVPSPRVADQARAAGAQQVLDCRGASA
AALLAAVQRSAAPAS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgagccaatggcgcctgctgctgacccggcctgccgaggactgcgcggcattggcgcaa
agcctggcggcggcaggggtgggcagcagttgcctgccgctgctggcgatagagcccgtc
gccttgggcgatcggcaacgcccattgctgaagggcctgcctggcttccaggcgatcatc
gtggtcagcaagccagctgccaggttgttgcttgaacaccttgcccaggccagcttgcag
ccgccacggcaaggctggttcaccgttggcgaggccactgcagcggtgctgcagggcgcg
ggcctggtggtgagcttcccgccgcgtggcgatgacagcgaagctttgctggcgctgccg
gccctgcggcaggcggttgccgtgcctgcgccgcgtatcttgatcgtgcgtggcgtcgga
ggtcgcgaactgctggcagagcgtcttgcagagcaaggtgctagtgtcgattatctggaa
ctgtatcgacgctgtctgccggcttacccggcgggcaccctgatgcgccgcatcgaagcg
gaacgcctcaatggcctggtggtcagcagtgggcaggggttcgaacatttgcagcagatg
gctggtgccgattggcccctggtggcgcgtctgccgctgttcgtgcccagcccgcgggtc
gccgatcaggcccgggccgccggggcccaacaggttttggattgccgtggcgccagtgcc
gcggccttgctggcagccgtgcagcgcagcgctgcacctgcctcttaa

DBGET integrated database retrieval system