KEGG   Pseudomonas putida S16: PPS_0321Help
Entry
PPS_0321          CDS       T01570                                 

Definition
formaldehyde dehydrogenase
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
ppt  Pseudomonas putida S16
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPS_0321
  Energy metabolism
   00680 Methane metabolism
    PPS_0321
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PPS_0321
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PPS_0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
373926..375107
Genome map
AA seq 393 aa AA seqDB search
MVYLGAGKVEVQKIDYPKMQDPRGKKIEHGVILKVVSTNICGSDQHMVRGRTTAQVGLVL
GHEITGEIVEKGRDVERMQIGDLVSVPFNVACGRCRSCKEMHTGVCLTVNPARAGGAYGY
VDMGDWTGGQAEYVLVPYADFNLLKLPERDKAMEKIRDLTCLSDILPTGYHGAVTAGVGP
GSTVYVAGAGPVGLAAAASARLLGAACVIVGDLNQARLAHAKSQGFEVVDLSKDTPLHEQ
IVDILGEPEVDCAVDAVGFEARGHGHEGAKHEAPATVLNSLMQVTRVAGNIGIPGLYVTE
DPGAVDAAAKIGALSIRFGLGWAKSHSFHTGQTPTMKYNRQLMQAIMWDRINIAEVVGVQ
VINLDQAPEGYGEFDAGVPKKFVIDPHKMWGAA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggtatatctcggcgccggcaaggtcgaggtgcagaagatcgactacccgaaaatgcag
gacccacgcggcaagaagatcgagcacggcgtgatcctgaaggtggtctccaccaacatc
tgcggctccgaccagcacatggtccgcggccgcaccactgcccaggtcggcctggtcctg
ggccacgaaatcaccggtgagatcgtcgagaagggccgtgacgtcgagcgcatgcagatt
ggcgacctggtctcggtgccattcaacgtcgcctgtggccgctgccgctcctgcaaggaa
atgcataccggtgtctgcctcactgtcaaccctgcccgcgctggcggtgcctatggttac
gtcgacatgggcgactggaccggcggccaggccgagtacgtgctggtgccgtacgctgac
ttcaacctgctgaaactgcccgagcgcgacaaggccatggagaagatccgtgacctgacc
tgcctatctgacatcctgcctactggttaccacggtgccgtgactgccggtgtaggccca
ggcagcaccgtctacgttgctggcgccggcccggtcggtctggctgccgctgcctcggcg
cgcctgctgggtgctgcttgcgtcatcgtcggcgacctcaaccaggcccgtctggctcac
gccaagtcccagggcttcgaagtggtcgacctgtccaaggataccccgctgcacgagcag
atcgtcgatatcctcggtgagccggaagtggactgcgccgtcgacgccgtcggcttcgaa
gcccgcggccatggccatgaaggtgccaagcatgaagccccggccaccgtgctgaactcg
ctgatgcaggttacccgcgttgccggcaacatcggtatcccgggcctgtacgtgaccgaa
gacccgggtgcggtggatgctgccgccaagatcggcgcgctgagcattcgctttggcctg
ggctgggccaagtcgcacagcttccacaccggccagaccccgaccatgaagtacaaccgc
cagctgatgcaggcaatcatgtgggatcgaatcaacatcgctgaagtggttggtgtgcag
gtgatcaacctggatcaggcgccggaaggttatggcgagttcgatgcaggtgtaccgaag
aagttcgtgatcgacccgcacaagatgtggggtgcggcgtga

DBGET integrated database retrieval system