KEGG   Pseudomonas putida S16: PPS_0418Help
Entry
PPS_0418          CDS       T01570                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01130  Biosynthesis of antibiotics
ppt01230  Biosynthesis of amino acids
Module
ppt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPS_0418
Enzymes [BR:ppt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PPS_0418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AEJ11003
UniProt: F8FZU3
Position
498953..499786
Genome map
AA seq 277 aa AA seqDB search
MSVPTVLERIIARKFQEVAERSARVSLAELEALAKAADAPRGFAKALIEQAARKQPAVIA
EIKKASPSKGVIRENFVPAEIAVSYEKGGATCLSVLTDVDYFQGADEYLQQARAAVSLPV
IRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAKDVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLAVTESGILNRADVELMAINE
VYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQQLD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgccgacggtgctggaaaggatcattgcccgcaagtttcaggaagtggccgag
cgcagcgcgcgcgtcagcctcgccgaactggaggccctggccaaggctgccgacgccccg
cgtggctttgccaaggccctgatcgagcaagccgcgcgcaagcagccggcggtgattgcc
gaaatcaagaaggcctcgccgagcaagggcgtgattcgcgagaatttcgtgccggcggaa
atcgccgtcagctacgagaagggcggggcgacctgcctgtcggtgctgaccgatgtggat
tacttccagggcgccgacgagtacctgcagcaggcccgcgcggcggtgtcgctgccggtg
atccgcaaggacttcatggtcgatccgtaccagattgtcgaggcccgggccttgggcgcg
gactgtgtgctgctgatcgtgtcggcgctggatgacgtgaagatggccgaactggcggcc
acggccaaggatgttggcctcgacgtgctggtggaagtgcacgatggcgatgaactggag
cgcgcgttgaaaaccctggatacaccgctggtgggggtgaacaaccgcaatctgcacacc
ttcgaggtcagcctggaaaccaccctcgacctgctgccgcgtattccgcgtgatcgcctg
gcggttaccgagagcggcatcttgaaccgggccgatgtggagctgatggcgatcaatgag
gtctactcgttcctggtaggtgaggcattcatgcgcgccgagcagccagggcttgaattg
cagcggttgttcttcccggaacaggtgaagaagactgttcagcaactggactga

DBGET integrated database retrieval system