KEGG   Pseudomonas putida S16: PPS_0418Help
Entry
PPS_0418          CDS       T01570                                 

Definition
Indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppt  Pseudomonas putida S16
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppt01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:ppt00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
498953..499786
Genome map
AA seq 277 aa AA seqDB search
MSVPTVLERIIARKFQEVAERSARVSLAELEALAKAADAPRGFAKALIEQAARKQPAVIA
EIKKASPSKGVIRENFVPAEIAVSYEKGGATCLSVLTDVDYFQGADEYLQQARAAVSLPV
IRKDFMVDPYQIVEARALGADCVLLIVSALDDVKMAELAATAKDVGLDVLVEVHDGDELE
RALKTLDTPLVGVNNRNLHTFEVSLETTLDLLPRIPRDRLAVTESGILNRADVELMAINE
VYSFLVGEAFMRAEQPGLELQRLFFPEQVKKTVQQLD
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgccgacggtgctggaaaggatcattgcccgcaagtttcaggaagtggccgag
cgcagcgcgcgcgtcagcctcgccgaactggaggccctggccaaggctgccgacgccccg
cgtggctttgccaaggccctgatcgagcaagccgcgcgcaagcagccggcggtgattgcc
gaaatcaagaaggcctcgccgagcaagggcgtgattcgcgagaatttcgtgccggcggaa
atcgccgtcagctacgagaagggcggggcgacctgcctgtcggtgctgaccgatgtggat
tacttccagggcgccgacgagtacctgcagcaggcccgcgcggcggtgtcgctgccggtg
atccgcaaggacttcatggtcgatccgtaccagattgtcgaggcccgggccttgggcgcg
gactgtgtgctgctgatcgtgtcggcgctggatgacgtgaagatggccgaactggcggcc
acggccaaggatgttggcctcgacgtgctggtggaagtgcacgatggcgatgaactggag
cgcgcgttgaaaaccctggatacaccgctggtgggggtgaacaaccgcaatctgcacacc
ttcgaggtcagcctggaaaccaccctcgacctgctgccgcgtattccgcgtgatcgcctg
gcggttaccgagagcggcatcttgaaccgggccgatgtggagctgatggcgatcaatgag
gtctactcgttcctggtaggtgaggcattcatgcgcgccgagcagccagggcttgaattg
cagcggttgttcttcccggaacaggtgaagaagactgttcagcaactggactga

DBGET integrated database retrieval system