KEGG   Pseudomonas putida S16: PPS_0550Help
Entry
PPS_0550          CDS       T01570                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00010  Glycolysis / Gluconeogenesis
ppt00020  Citrate cycle (TCA cycle)
ppt00620  Pyruvate metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01130  Biosynthesis of antibiotics
ppt01200  Carbon metabolism
Module
ppt_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPS_0550
   00020 Citrate cycle (TCA cycle)
    PPS_0550
   00620 Pyruvate metabolism
    PPS_0550
Enzymes [BR:ppt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PPS_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Biotin_lipoyl Hydrolase_4 Thioesterase Abhydrolase_3 Esterase Ndr Ser_hydrolase Abhydrolase_5 GCV_H PGAP1 PAF-AH_p_II Esterase_phd
Motif
Other DBs
NCBI-ProteinID: AEJ11135
UniProt: F8G2E5
Position
complement(626902..628008)
Genome map
AA seq 368 aa AA seqDB search
MSQIHTLTMPKWGLSMTEGRVDTWLKQEGDEISKGDEVLDVETDKISSSVEAPFSGVLRR
QVARPDETLPVGALLAVVVEGEAEEAEIDAVVQRFQAEFVAEGGADQAQGPAPQKAEVAG
RQLRWFELGEGGTPLVLVHGFGGDLNNWLFNHPALAAERRVIALDLPGHGESAKALQRGD
LDELSETVLALLDHLDIAKAHLAGHSMGGAVSLNVARLAPQRVASLSLVASAGLGEEING
QYLQGFVAAANRNALKPQMVQLFADPALVTRQMLEDMLKFKRLEGVDDALRLLASAIADG
DRQRHDLRGVLGQHPALVVWGGKDAIIPASHAEGLEAEVLVLPEAGHMVQMEAAEQVNQQ
LLAFLRKH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatccataccctgaccatgcccaagtggggcttgtcgatgaccgagggccgg
gtggatacctggctgaagcaggaaggtgacgaaatcagcaagggcgacgaggtgctggac
gtcgagaccgacaagatcagcagcagcgtcgaagccccgttcagcggtgtgttgcgccgt
caggtggccaggcctgatgaaaccctgccggtcggagccctgctggcggtggtggtggaa
ggcgaagccgaagaagccgaaatcgatgccgtggtgcagcgcttccaggccgagttcgtc
gccgagggtggcgccgaccaggcccaagggccggcgccacagaaggctgaagtggctggc
cggcagttgcgctggttcgagctgggtgaaggcggcacgccgctggtgctggtgcacggt
tttggtggcgacctcaacaactggctgttcaaccacccggcgctggctgccgagcgacgg
gtaatcgccctcgacctgccgggccatggcgagtcggccaaggccctgcaacggggcgat
ctggatgagttgagcgaaaccgtactggccctgctcgaccacctggacatcgccaaggcc
cacctggccggccactccatgggcggcgcggtcagcctgaatgtggcgcgcctggcgccg
caacgggtggccagcctgagcctggtggccagtgccgggctgggcgaggagatcaacgga
cagtacctgcaaggcttcgtcgctgccgctaaccgcaatgccctcaaaccgcagatggta
cagctgtttgccgaccccgcactggtaacgcggcagatgctggaggacatgctcaagttc
aagagactggaaggcgtggacgacgcgttgcgcctgttggcatcggccatcgccgacggc
gaccggcagcgccacgacctgcgcggggtgctgggacaacacccggccctggtggtgtgg
ggcggcaaggacgcgatcatcccggccagccatgccgaagggctggaggctgaagtgctg
gtgctgcccgaggctggccatatggtgcaaatggaggcggccgaacaggtcaaccagcaa
ctgctcgcgttcctgcgcaagcactaa

DBGET integrated database retrieval system