KEGG   Pseudomonas putida S16: PPS_0662Help
Entry
PPS_0662          CDS       T01570                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppt  Pseudomonas putida S16
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPS_0662
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPS_0662
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PPS_0662
Enzymes [BR:ppt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PPS_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
757357..758745
Genome map
AA seq 462 aa AA seqDB search
MQYTSTRGNETRVDFRTALLSGLADDGGLYVPTAVPTFSQQDIASWSWLPFDELAWRVMA
PFVGDTLDEPTLRALVSDSYRGFKHRGIAPLQQIGHNEWILQLFHGPTRSSKDFAAQLQA
RLIRHFLGPDCERVMLVGASNGDTAVAAIEALRHCPTARLLALYPSAGTPADRAAVMRSA
ASESVSCVAVDGSFDDCQSLVSTLLRAWPCPGLIPVSFNSTNWVGVLAQIVFYFHAALQL
GGGIRPVGFSIPTASFAEIYAGFIAQKMGLPINQIIVSTNRNDALHRFIHCNRYSRGSTS
QTLSPVMDFSLFSNLERFVWELYDRDGGATRALMEHFEDCGELSIGNRQWLHARMLFDSY
AVDDALIREEIVTLFQETGCAVDPHAATGAFAGRLHRRNIGAPIVTLGQFAPEKSAGLLA
ELGAWHGEVPACGVGSAGSGPLLAPEDLAGVHEILARLQAGR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacacatccacgcgcggcaacgagacacgggttgatttccgcacggcgctgctt
tccgggctggccgacgatggcgggctttacgtgccgactgcggtgccgacgttcagccag
caggatattgccagctggtcgtggttgccgttcgacgaactggcctggcgggtaatggcg
ccgtttgtcggcgacacgctcgatgagccgaccctgagggcgctggtaagcgacagctac
cgcggcttcaagcaccgtggcatcgcaccgttgcagcagattggccataacgaatggatc
ctgcagctgtttcacgggcctacccgttcctccaaggatttcgccgcgcagttgcaggcg
cggctcattcgccatttcctggggcccgattgcgaacgggtcatgctggtcggtgccagc
aacggcgatacggcggtggccgctatcgaagccttgcggcattgccctacggcacgcttg
ctggcgctttaccctagtgccgggacaccggccgaccgggcggcggtgatgcgcagtgct
gcttccgaaagcgtgagctgcgtggccgtggacggcagcttcgatgactgccagtcactg
gtgtcgacgttgctgcgtgcatggccgtgccccgggctgattcccgtgagcttcaactcg
accaactgggtcggcgtgctggcgcagatcgtgttctatttccacgcggcgcttcagctg
ggtggtgggattcggccggtgggtttcagcatccccacggccagttttgccgagatctac
gcggggttcattgcccagaaaatgggcctgccgatcaaccagatcattgtttccaccaac
cgcaacgatgccttgcaccggttcatccactgcaatcgctacagccgtggttccaccagc
cagaccttgtcgccggtcatggacttttcgctgttctccaacctggaacgtttcgtctgg
gagctgtatgaccgcgatggtggggcgacccgggcactgatggagcatttcgaggattgt
ggcgagttgagcatcggcaaccgccagtggctgcacgcgcgcatgctgttcgactcctac
gccgtggatgacgcgctgattcgcgaagaaatcgtcacgctgttccaggaaaccggctgc
gcagtagacccacacgctgccaccggggcattcgccgggcgcctgcaccggcgcaacatt
ggtgcgccgatcgtcacgctgggccagtttgccccggaaaagtctgccgggttgctggcg
gagcttggggcctggcatggcgaggtgccggcctgtggtgttggcagcgcgggcagtggg
ccgctgctggcgccagaggacctggcgggggttcatgagatattggcccggttgcaggca
ggacgatga

DBGET integrated database retrieval system