KEGG   Pseudomonas putida S16: PPS_0833Help
Entry
PPS_0833          CDS       T01570                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00480  Glutathione metabolism
ppt00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PPS_0833
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PPS_0833
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PPS_0833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEJ11412
UniProt: F8FUG4
Position
938899..939432
Genome map
AA seq 177 aa AA seqDB search
MGVIRLRGNREPERGFIMSAFHDLKLDALNGGELPLAPFKGQVVLVVNVASKCGLTPQYK
ALENLYQNYKDKGFNVLGLPCNQFAGQEPGSEKEIQEFCSLNYGVSFPLGAKLEVNGPQR
HSLYRLLAGEGAEFPGDITWNFEKFLVGKDGRVLARFSPRTAPDDPAVVQAIEKALA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgtaattcgcctgcgcggcaaccgggaacctgagaggggattcatcatgagtgca
tttcacgacctgaaactggacgcattgaacggcggggagctgcccctcgcaccgttcaag
ggccaagtggtgctggtggtcaacgttgcctccaagtgtggcctcacgccgcaatacaag
gccctggagaacctctaccagaattacaaggacaagggcttcaacgtgcttggccttccg
tgcaaccagtttgccgggcaggagcctggcagcgaaaaggaaattcaggagttctgcagc
ctcaactacggggtgagcttcccgctgggtgccaagctggaggtcaacgggccgcagcgc
cattcgctgtaccgactgctggcgggtgagggggcggagttcccgggcgacattacctgg
aacttcgagaagttcctggtgggcaaggacgggcgggtgctggcgcgtttttcgccgcgc
acggcgccggatgatcctgcggtggtgcaggctatcgagaaagccttggcctga

DBGET integrated database retrieval system