KEGG   Pseudomonas putida S16: PPS_0994Help
Entry
PPS_0994          CDS       T01570                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppt  Pseudomonas putida S16
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppt01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ppt00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1107476..1108801
Genome map
AA seq 441 aa AA seqDB search
MTVSTAIARLNAADPDFARHLDHLLSWESVSDDAVNQRVLDIIKAVRERGDAALVEFTQR
FDGVDAKSIDDLILGRERLELALTRITPAQREALEKAANRVRMYHERQKQDSWQYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVAEVVMVVPTPRGEVNELVLA
AACIAGVDRVFTVGGAQAVAALAYGTESVPQVDKIVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAAFLDRVAASIDKLLPTMER
AEIIEKSINGRGALIQVRDMQQAMEVANRIAPEHLELSVADPQAWLPHIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIFCSEQGASELGHTASVLARG
ESLTAHARSAEYRILTQEKGN
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgtccactgcaattgcccgtctcaacgctgctgatccggatttcgcccgacat
ctggatcatctgctgagctgggaaagtgtgtccgatgacgcggtcaaccagcgcgtgctc
gacatcatcaaggccgtgcgcgagcgcggcgatgcggcactggtggaattcacccagcgt
ttcgatggtgtcgatgccaagtccatcgatgacctgatcctcggtcgcgagcgcctggaa
ctggcgctgacccgcattaccccggcccagcgcgaagccctggaaaaggctgccaaccgt
gtgcgcatgtaccacgagcggcagaagcaggactcctggcagtacactgaggccgacggt
accgtgctcggccagaaggtcaccccgctggaccgcgccggcctgtacgtgccgggtggc
aaggcgtcgtacccatcgtcggtgctgatgaacgccatcccggccaaggtcgccggcgtg
gccgaagtggtgatggtggtgccgaccccgcgtggcgaggtcaacgaactggtgctggcg
gctgcctgcatcgccggtgtcgaccgtgtgttcaccgtcggcggcgcccaggctgtcgcc
gcgctggcctacggtaccgaaagcgtgccgcaggtggacaagatcgtcggcccgggcaac
atctacgtcgccaccgccaagcgccatgtgttcggccaggtgggtatcgacatgatcgcc
ggtccgtcggaaatcctcgtggtatgcgacggccagaccgacccggactggatcgccatg
gacctgttctcccaggccgagcacgatgaagacgcccaggccatcctggtcagcccggac
gccgccttcctcgaccgcgttgccgccagcatcgacaagctgctgccgaccatggaacgt
gccgagatcatcgagaagtcgatcaatggccgtggcgcgctgattcaggtgcgtgacatg
cagcaggccatggaagtggccaaccgcattgccccggagcacctggaactgtcggtcgcc
gacccgcaggcctggctgccgcacatccgccacgctggcgcgatcttcatgggccgccac
accagcgaagcgctgggcgactactgcgcagggcccaaccacgtgctgccgacctccggt
accgcgcgtttctcgtcgccgctgggggtgtatgacttccagaagcgttcgtcgatcatt
ttctgctccgagcagggcgcgtccgagctgggccacaccgcctcggtcctggcccgtggc
gagtcgctgaccgcccacgcccgcagcgccgaataccgcattctgacccaagagaagggg
aactga

DBGET integrated database retrieval system