KEGG   Pseudomonas putida S16: PPS_1040Help
Entry
PPS_1040          CDS       T01570                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppt  Pseudomonas putida S16
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPS_1040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPS_1040
   00052 Galactose metabolism
    PPS_1040
   00500 Starch and sucrose metabolism
    PPS_1040
   00520 Amino sugar and nucleotide sugar metabolism
    PPS_1040
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPS_1040
   00524 Butirosin and neomycin biosynthesis
    PPS_1040
Enzymes [BR:ppt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PPS_1040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1157159..1158118
Genome map
AA seq 319 aa AA seqDB search
MKDLLVGDIGGTNARFALWRDNQLHEVKVFATEDYTSPEQAIEAYLEGLGIPRGGVTAAC
LAVAGPVDGDEFRFTNNHWRLSRVAFCQTLQVERLLLINDFTAMALGMTRLRPGEFREVC
PGQADLSRPALVIGPGTGLGVGALLRLGEQHWHALPGEGGHVDLPVGNAREAAIHQQIHG
QIGHVSAETVLSGGGLLRLYQAICALDGDTPRHKTPAQITDAALGGEPRALAVIEQFCRF
LGRVAGNNVLTLGARGGVYIVGGVIPRFAELFLRSGFAASFSDKGCMSGYFAGVPVWLVT
AEFSGLLGAGVALQQAQVH
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacctgctggttggcgacatcggcggcaccaatgcccgttttgcgttgtggcgt
gacaaccagctgcatgaagtgaaggtctttgccaccgaggactacaccagcccggaacag
gccatcgaggcttacctcgaaggcttgggcattccccgcggcggcgtgactgctgcctgc
ctggcggtggccgggccggtcgatggcgatgagttccgcttcaccaacaaccactggcgc
ctcagccgcgtggccttctgccagacattgcaggtcgagcggctgctgctgatcaacgat
tttaccgctatggcgctgggcatgacccgcctgcgccccggcgaattccgcgaagtatgc
ccaggccaggcggacctgtctcggccggcattggtcattggcccgggtaccgggctgggc
gttggcgcgctattgcgcctgggcgaacagcactggcatgccttgccgggagagggcggg
cacgtcgacctgccggtgggcaatgcccgcgaagcggcgattcaccaacagattcacggg
cagatcggccatgtcagcgccgagaccgtgctcagtggcggtggcctgctgcgcctgtac
caggcaatttgcgcgctggacggcgacacaccccgacacaagaccccggcacagatcacc
gatgccgcgctcggcggcgagccgcgggcgctggcggtgatcgagcagttctgccggttc
ctcggccgagtcgctggtaacaatgttctgacgctgggcgcgcggggtggggtctatatt
gtcggcggcgtgatcccgcgctttgccgagctgttcctgcgcagcgggtttgccgcgagt
ttttccgacaagggctgcatgagtggctatttcgctggcgtgccggtttggctggtgacg
gcggagttttccgggttgctgggggccggggtggctttgcaacaggcgcaggttcactga

DBGET integrated database retrieval system