KEGG   Pseudomonas putida S16: PPS_1052Help
Entry
PPS_1052          CDS       T01570                                 

Definition
6-phosphogluconolactonase
Orthology
K01057  
6-phosphogluconolactonase [EC:3.1.1.31]
Organism
ppt  Pseudomonas putida S16
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPS_1052
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PPS_1052
Enzymes [BR:ppt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     PPS_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1171306..1172034
Genome map
AA seq 242 aa AA seqDB search
MGGRGMGISELKLPATVTVHELADAKALAAAQAHDVAERLRAAIAAKGQACVVLSGGRSP
VPFLEKLASENLDWAKVTVSLADERWVPVEHADSNAGLLARHLFKGAAAKARFVGLYQQA
ENLDAAAGKADQALAELPPIDVLVLGMGDDGHTASLFPASPNLEAGLDLANPRRCLPLLA
PSVPRQRLSMTRSLLASSAFTALSLQGQGKLATLRAALAGTDLSEMPIRAFLHAPLDIYW
CP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggagggcgtggtatggggatatctgaactgaaactgccagcgactgtgacggtacat
gagctggcggatgccaaggctctggccgcagcccaggcccatgacgtggccgagcgcctg
cgcgcagccattgccgccaagggccaggcctgcgtggtgctatccggcggccgtagcccg
gtaccgtttctcgagaagctggccagcgaaaacctcgactgggccaaggtcaccgtcagc
ctggccgatgagcgctgggtgccggtggagcatgccgacagcaatgccggcctgctggcg
cgccacctgttcaagggcgcggcggccaaggcccgcttcgttggtctttaccagcaggcg
gagaaccttgatgccgctgcaggcaaggccgatcaggccttggccgagctgccgccaatt
gacgtactggtgctgggcatgggggatgatggccatacagcttcgctgttccccgccagc
cccaacctggaagcaggcctcgacctggccaacccacgccgctgcctgcctttgctggca
ccgagcgtaccgcgccagcgcctttcgatgacccgctcgctgctggccagttccgccttt
accgcgctgtccctacaagggcagggcaaactcgctaccctgcgcgccgcgctggctggc
accgacctttccgaaatgccgatacgcgcttttcttcacgcccccctggacatctactgg
tgcccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system