KEGG   Pseudomonas putida S16: PPS_1052Help
Entry
PPS_1052          CDS       T01570                                 

Definition
(GenBank) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00030  Pentose phosphate pathway
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01130  Biosynthesis of antibiotics
ppt01200  Carbon metabolism
Module
ppt_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ppt_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
ppt_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PPS_1052
Enzymes [BR:ppt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     PPS_1052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-ProteinID: AEJ11627
UniProt: F8FXC1
Position
1171306..1172034
Genome map
AA seq 242 aa AA seqDB search
MGGRGMGISELKLPATVTVHELADAKALAAAQAHDVAERLRAAIAAKGQACVVLSGGRSP
VPFLEKLASENLDWAKVTVSLADERWVPVEHADSNAGLLARHLFKGAAAKARFVGLYQQA
ENLDAAAGKADQALAELPPIDVLVLGMGDDGHTASLFPASPNLEAGLDLANPRRCLPLLA
PSVPRQRLSMTRSLLASSAFTALSLQGQGKLATLRAALAGTDLSEMPIRAFLHAPLDIYW
CP
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggagggcgtggtatggggatatctgaactgaaactgccagcgactgtgacggtacat
gagctggcggatgccaaggctctggccgcagcccaggcccatgacgtggccgagcgcctg
cgcgcagccattgccgccaagggccaggcctgcgtggtgctatccggcggccgtagcccg
gtaccgtttctcgagaagctggccagcgaaaacctcgactgggccaaggtcaccgtcagc
ctggccgatgagcgctgggtgccggtggagcatgccgacagcaatgccggcctgctggcg
cgccacctgttcaagggcgcggcggccaaggcccgcttcgttggtctttaccagcaggcg
gagaaccttgatgccgctgcaggcaaggccgatcaggccttggccgagctgccgccaatt
gacgtactggtgctgggcatgggggatgatggccatacagcttcgctgttccccgccagc
cccaacctggaagcaggcctcgacctggccaacccacgccgctgcctgcctttgctggca
ccgagcgtaccgcgccagcgcctttcgatgacccgctcgctgctggccagttccgccttt
accgcgctgtccctacaagggcagggcaaactcgctaccctgcgcgccgcgctggctggc
accgacctttccgaaatgccgatacgcgcttttcttcacgcccccctggacatctactgg
tgcccatga

DBGET integrated database retrieval system