KEGG   Pseudomonas putida S16: PPS_1119Help
Entry
PPS_1119          CDS       T01570                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ppt  Pseudomonas putida S16
Brite
Enzymes [BR:ppt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PPS_1119
Secretion system [BR:ppt02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   PPS_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1251662..1252405
Genome map
AA seq 247 aa AA seqDB search
MRVTQFFAAAALALASTFAAAAATDSNAAAEQAIRKSLQNLELEVPVESVASSPVSGLYE
VKLQGGRVLYASGDGQFVMQGYLFQIQDGKPVNLTEKTERLGIAKLINGIPAAEMVVYPA
KGETKSHITVFTDTTCPYCHKLHAEVPELNRRGIEVRYVAFPRQGLGSSGDQQLQAVWCS
SDRRAAMDKMVEGEEIKAAKCANPVSKQFQLGQSIGVNGTPAIVLESGQVIPGYQPAPQV
AKLALAK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtgacccagtttttcgccgccgccgcgttggcgctggccagtacctttgccgct
gccgcggcaaccgatagcaatgctgctgccgagcaggccatccgtaagtcattgcagaac
cttgagctggaagtgcccgtcgaaagcgtggccagcagcccggtcagcggcctctatgaa
gtcaagctgcagggcggccgcgtgctgtatgccagcggcgacggccagttcgtgatgcag
ggctacctgttccagatccaggacggcaagccggtcaacctcaccgagaagaccgagcgc
ctgggcattgccaagctcatcaacggcattccagccgccgagatggtggtttatcctgcc
aaaggcgagaccaagtcgcacatcaccgtgttcaccgacaccacctgcccgtactgccac
aagctgcacgccgaggtgcccgagctcaaccgccgcggtatcgaagtgcgctatgtcgcc
ttcccgcgccagggcctcggttcgtcgggtgaccagcagttgcaggctgtctggtgttcc
agcgaccgccgtgcggcgatggacaagatggtcgagggtgaggaaatcaaggccgccaag
tgcgccaacccggtcagcaagcagttccagctgggccagtcgatcggcgtcaatggcacg
ccggcgattgtccttgaaagcggccaggtcattccgggctaccagccggcaccgcaggtc
gccaagctggcactggccaagtaa

DBGET integrated database retrieval system