KEGG   Pseudomonas putida S16: PPS_1181Help
Entry
PPS_1181          CDS       T01570                                 

Definition
oxidoreductase, FAD-binding protein
Orthology
K00537  
arsenate reductase [EC:1.20.4.1]
Organism
ppt  Pseudomonas putida S16
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1318555..1318902)
Genome map
AA seq 115 aa AA seqDB search
MTYTLYGIKACDTMKKARTWLEDQAIAYEFHDYKAQGIDRDSLNRWCEEHGWEVILNRAG
TTFRKLDDASKADLDQAKAVELMLAQPSMIKRPVLDLGARTLVGFKPDLYAAALA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgacctacacgctctacggcattaaagcctgtgacaccatgaaaaaggcacgtacctgg
ctcgaagaccaggccatcgcctacgaattccacgactacaaggcccaaggcatcgaccgt
gacagcctgaaccgctggtgcgaggaacacggctgggaagtcatcctcaaccgtgccggc
accaccttccgcaagctggacgacgccagcaaggccgacctcgaccaggccaaggccgtc
gagctgatgctggcccagccgtcgatgatcaagcgcccggtgctcgaccttggcgcgcgc
accctggtcggcttcaagcccgacctgtacgccgctgccctggcctga

DBGET integrated database retrieval system