KEGG   Pseudomonas putida S16: PPS_1215Help
Entry
PPS_1215          CDS       T01570                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ppt  Pseudomonas putida S16
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1357903..1358577
Genome map
AA seq 224 aa AA seqDB search
MREDDMLRRGIGMTSQRTRERLIQRLCEEGVSNTKVLDVIRRTPRHLFVDEALAHRAYED
TALPIGHNQTISQPFMVAHMSELLLEAGPLDKVLEIGTGSGYQTAILAQLVERVFSVERI
KVLQDRAKERLVELNLRNVVFRWGDGCEGWPALAPYNGIIVTAVAPEVPQALLDQLAPGG
RMVIPVGPAGETQQLMLIVREEHGFSRRVLGAVRFVPLLNGPLA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaggacgatatgctgcggcgtggcatcggcatgacctcccagcgcacccgggag
cggctgatccagcgcctgtgcgaggagggcgtttcgaacaccaaggtgctcgacgtcatc
cgtcgtaccccgcgccacctgttcgtcgacgaggcgctggcgcatcgcgcctacgaagac
accgcgctgccgatcggccacaaccagacgatctcgcaaccgttcatggttgcccacatg
agtgaactgctgctcgaggccgggccgctggacaaggtgctcgagatcggcaccggctcg
ggctaccagacggcaatcctggctcagttggtcgagcgggtgttctcggtggaacgcatc
aaggtgttgcaggaccgggccaaggagcgcctggtggagctgaacctgcgcaacgtggtg
ttccgctggggggatggttgcgaaggctggccggcgctggcgccgtacaacggcatcatc
gtcaccgccgtagcgccggaagtgccgcaggcactgctcgaccagcttgcgccgggtggc
cgtatggtgatcccggtgggcccagccggcgaaacccagcagctgatgctgatcgtgcgc
gaggagcatggattctcccgccgcgtgctgggggccgtgcgcttcgtaccgctgctcaac
ggcccgctggcctga

DBGET integrated database retrieval system