KEGG   Pseudomonas putida S16: PPS_1422Help
Entry
PPS_1422          CDS       T01570                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00521  Streptomycin biosynthesis
ppt00523  Polyketide sugar unit biosynthesis
ppt01130  Biosynthesis of antibiotics
Module
ppt_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PPS_1422
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PPS_1422
Enzymes [BR:ppt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PPS_1422
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AEJ11997
UniProt: F8G3Q8
Position
complement(1573220..1573768)
Genome map
AA seq 182 aa AA seqDB search
MQAIPLDIPEVVLFTPKVFGDERGFFYESFNARVFNEVTGLQPDFVQDNHSRSVKGVLRG
LHYQLAPHAQGKLVRVVQGEVFDVAVDIRRSSPTFGKWVGAVLSAENKNQLWIPPGFAHG
FVTLSETAEFLYKTTDFYSPKCERCIAWDDPAVGIEWPIDFIPSLSGKDQLGVALADAEL
FE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccattccgctggacatccccgaagtcgtcctgtttacccccaaggtattcggc
gacgaacgtggcttcttctacgaaagcttcaatgcccgtgtgttcaatgaagtaaccggg
ctgcagcctgactttgtacaagacaaccactcgcgctcggtaaaaggcgtgctccgtggc
ctgcactatcagctggcacctcacgcacagggcaagctggtacgcgtggtgcagggcgag
gtttttgacgttgcggtggatatccgtcgctcgtcccccaccttcggtaaatgggttggg
gcggtgctgtcggccgagaacaagaaccaactgtggatcccgccagggttcgcgcacggc
ttcgtcacgttgagtgaaaccgcagagttcctctacaagacaaccgacttctactcgccg
aagtgcgagcgctgcattgcctgggatgatccggcagtcggcatcgaatggcctatcgac
ttcatcccaagcctgtccggcaaggaccagcttggggtcgcgttggctgatgccgagctg
ttcgagtaa

DBGET integrated database retrieval system