KEGG   Pseudomonas putida S16: PPS_1511Help
Entry
PPS_1511          CDS       T01570                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ppt  Pseudomonas putida S16
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PPS_1511
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PPS_1511
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PPS_1511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1675167..1675655
Genome map
AA seq 162 aa AA seqDB search
MAGSILDIPCVTLGGEHKKLGDFPGKALLVVNTASQCGFTPQYKGLEQLWQAYRARGLVV
LGFPCNQFGKQEPGDAREIAQFCQRNFGVSFPLFRKVEVNGPGSHPLFVELKQRAPGILG
SQKIKWNFTKFLVDPASGQVTRYAPTTKPQALEADIERLLSR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atggctggatcgatactggacatcccctgcgtgaccctgggcggcgagcacaagaagctc
ggcgacttccccggcaaggcgctgctggtggtcaataccgccagccagtgcggctttacc
ccgcagtacaagggcctggagcaactgtggcaggcttatcgcgcgcgtggcctggtggtg
ctgggcttcccctgcaaccagttcggcaagcaggagccgggcgatgcacgggaaattgcc
cagttctgccagcgcaatttcggcgtgagcttcccgctgttccgcaaggtcgaggtcaac
ggccccggcagccatccgctgttcgtcgaactcaagcagcgcgcgccgggcattctgggc
agccagaagatcaagtggaacttcaccaagttcctggtcgacccggcctctggccaggta
acgcgctacgcccccaccaccaagccgcaggccctggaagcggacatcgagcgcctgctc
agccgttga

DBGET integrated database retrieval system