KEGG   Pseudomonas putida S16: PPS_1825Help
Entry
PPS_1825          CDS       T01570                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppt  Pseudomonas putida S16
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPS_1825
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPS_1825
   00620 Pyruvate metabolism
    PPS_1825
   00640 Propanoate metabolism
    PPS_1825
  Energy metabolism
   00680 Methane metabolism
    PPS_1825
Enzymes [BR:ppt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PPS_1825
Lipid biosynthesis proteins [BR:ppt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PPS_1825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2043115..2044761
Genome map
AA seq 548 aa AA seqDB search
MRDYTEAARAFDHGQAAAAALHGNLEALNACVECCDRHAGEGKTALVWEDREGNSVRLSF
DQLQALAARFANVLEAQGVGAGDRVAGLMPRTPELLVTILATWRLGAVYQPLFTAFGPKA
IEHRLEQSHARVVVTDSHNRAKLDDVHACPTIITVNARNGELDFQQCLDKAADKCEPVMR
SGNDPFLLMFTSGTTGPAKPLEVPLRAIVAFQGYMRDAIDLRPEDNFWNLADPGWAYGLY
YAVTGPLSLGHATTFYDGPFSVESCARVIDKLGITNLAGSPTAYRLLIAAGDDFSAPIKG
RLRVVSSAGEPLNPEVIRWFADELGVTIHDHYGQTELGMVLCNHHGLQHPVHLGSAGFAI
PGHRIVVLDEQGNELPAGQPGILAVDREQSPLCWFAGYHGLPTKAFVGKYYLSGDTVELN
QDGSISFVGRSDDVITTSGYRVGPFDVESALIEHPAVIEAAVIGKPDPERTELIKAFVVL
ASGYQGSAELEEALRQHVRQRLYAHAYPREIEFVSELPKTPSGKLQRFILRNQEVAKQQA
QQATPASA
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgattacaccgaggccgctcgtgcgttcgaccatggccaggctgctgcggcggcg
ctgcatggcaacctcgaagccctcaatgcctgtgtcgaatgttgcgaccgccatgccggt
gagggcaagaccgcactggtctgggaagaccgcgagggcaacagcgtgcgcttgagcttc
gaccagttgcaggcactggcggcccgtttcgccaatgtgctcgaagcgcaaggcgtgggt
gcgggtgaccgggtcgccggcctgatgccgcgtacccccgagctgctggtcaccatcctc
gccacctggcgtctcggcgcggtgtaccagccactgttcaccgcgttcggccccaaggcc
atcgaacatcgcctggagcagtcccacgcccgcgtggtcgtcaccgacagccacaaccgc
gccaagctggacgatgtgcacgcctgcccgaccatcatcaccgtcaatgcccgcaatggc
gagctggacttccagcagtgcctggacaaagccgcagacaaatgcgagccggtcatgcgc
tcgggcaacgacccgttcctgctgatgttcacctccggcaccaccggcccggctaaaccg
ctggaagtgccgctgcgtgccatcgtcgcgttccagggctacatgcgcgatgccatcgac
ctgcgccccgaggacaacttctggaacctggccgacccgggctgggcctatggcctgtat
tatgcggtcactggcccgctgtcgctgggccatgccaccaccttctacgatggcccgttc
agtgttgaaagctgcgcacgggtgatcgacaagctgggcatcaccaacctggccggctcg
cccaccgcgtaccgcctgctgattgccgccggggatgacttctcggcaccgatcaagggc
cgcctgcgggtggtcagcagtgccggtgaaccgctcaacccggaagtgatccgctggttc
gccgacgaactgggcgtgaccatccacgaccactacgggcagaccgaactgggcatggtg
ctgtgcaaccaccatggcctgcagcacccggtacacctcggctcggccggcttcgccatc
cccggccaccgcatcgtggtgctggacgagcagggcaacgaactgcctgccgggcagccg
ggcatcctcgcggtcgaccgcgagcagtcgccgctgtgctggttcgcgggctaccacggc
ctgccgaccaaagccttcgtcggcaagtactacctcagtggcgacaccgtcgaactgaac
caggacggcagcatcagcttcgtcggccgcagcgacgatgtgatcaccacctccggctac
cgggtcggcccgttcgacgtcgagagtgcactgatcgagcacccagcggtgatcgaagcg
gcggtgatcggcaaaccggacccggagcgcaccgaactgatcaaggccttcgtggtattg
gccagcggttaccagggcagcgccgagcttgaagaggctttgcgccagcacgtgcgccag
cgcctgtacgcccatgcctacccaagggaaatcgaattcgtcagcgagctgcccaagacc
ccgagcggcaagctgcaacgcttcatcctgcgcaaccaggaagtcgccaaacaacaagcg
caacaggccacccctgccagcgcctga

DBGET integrated database retrieval system