KEGG   Pseudomonas putida S16: PPS_1829Help
Entry
PPS_1829          CDS       T01570                                 

Definition
(GenBank) enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00071  Fatty acid degradation
ppt00280  Valine, leucine and isoleucine degradation
ppt00281  Geraniol degradation
ppt00310  Lysine degradation
ppt00360  Phenylalanine metabolism
ppt00362  Benzoate degradation
ppt00380  Tryptophan metabolism
ppt00410  beta-Alanine metabolism
ppt00627  Aminobenzoate degradation
ppt00640  Propanoate metabolism
ppt00650  Butanoate metabolism
ppt00903  Limonene and pinene degradation
ppt00930  Caprolactam degradation
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01130  Biosynthesis of antibiotics
ppt01212  Fatty acid metabolism
Module
ppt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PPS_1829
   00650 Butanoate metabolism
    PPS_1829
  Lipid metabolism
   00071 Fatty acid degradation
    PPS_1829
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PPS_1829
   00310 Lysine degradation
    PPS_1829
   00360 Phenylalanine metabolism
    PPS_1829
   00380 Tryptophan metabolism
    PPS_1829
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PPS_1829
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PPS_1829
   00281 Geraniol degradation
    PPS_1829
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PPS_1829
   00627 Aminobenzoate degradation
    PPS_1829
   00930 Caprolactam degradation
    PPS_1829
Enzymes [BR:ppt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PPS_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEJ12398
UniProt: F8FW64
Position
2047896..2048669
Genome map
AA seq 257 aa AA seqDB search
MAFETILLDIHGKVGLITLNRPQALNALNAQIVGEINQALDQLERDPNIGCVVLTGSAKA
FAAGADIKEMAELQYPQIYVDDLFSDSDRIANRRKPIIAAVSGFALGGGCELAMMCDFIL
AADNARFGQPEINLGVLPGMGGTQRLTRAVGKAKAMELCLTGRLMGAEEAERAGLVARIV
PQAELVEEALKVAATIASKSIPVSMMVKESVNRAFEVTLSEGVRFERRVFHAAFATEDQK
EGMAAFIAKREAQFKDR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcattcgaaactatcctgttggatatccacggcaaggtcggcctgattaccctcaac
cgcccgcaggcgctgaacgcgctgaacgcgcagatcgtcggcgagatcaaccaggccctg
gaccagctcgagcgcgatccgaacatcggctgcgtggtgctgaccggttccgccaaggcc
tttgccgctggtgccgacatcaaggaaatggccgagctgcaatacccgcaaatctacgtt
gacgacctgttcagcgattccgaccgcattgccaaccggcgcaagccgatcattgccgcg
gtgtccggttttgccctgggcggcggctgcgagctggcgatgatgtgtgacttcatcctg
gcggcggacaatgccaggtttggccagccggaaatcaaccttggcgtgctgccgggcatg
ggcggcacccagcgcctgacccgtgcggtgggcaaggccaaggccatggaactttgcctg
accggtcgcctgatgggggctgaggaagcggagcgtgccgggttggtggcgcgtatcgtg
ccgcaggctgagctggtggaagaggcgctgaaggtggccgcgaccattgccagcaagtcg
attccggtgagcatgatggtcaaggagagcgtcaaccgtgcgttcgaagtcaccctcagc
gaaggtgtgcgcttcgagcggcgggtgttccatgcggcgtttgctaccgaagaccagaaa
gaggggatggctgcgttcattgccaagcgcgaggcgcagttcaaggaccgctga

DBGET integrated database retrieval system