KEGG   Pseudomonas putida S16: PPS_1901Help
Entry
PPS_1901          CDS       T01570                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ppt  Pseudomonas putida S16
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PPS_1901
Enzymes [BR:ppt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PPS_1901
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PPS_1901
Lipid biosynthesis proteins [BR:ppt01004]
 Fatty acid synthase
  Component type
   PPS_1901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2128881..2129480
Genome map
AA seq 199 aa AA seqDB search
MWWLSAGLALYCLAQSAAAGTLLVVGDSISAGFGLDTRQGWVSLLQTRLRDEGFDDKVVN
ASISGDTSAGGQARLPALLAAHKPSLVVLELGGNDGLRGQPPAQLQQNLASMIESSRNAG
AKVVLLGMRLPPNYGVRYTTAFAQVYEQLAAEKQVPLVPFFLEGVGGVPELMQADGIHPA
QAAQQRLLENAWPAIKPLL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtggttgagtgccggtctggccctgtattgcctggcccagagcgcggcggcggga
acactgctggttgtcggcgatagtatcagcgccggttttggcctggatacccgccagggc
tgggtttccctgttgcagacccgcctgcgggacgaaggtttcgacgacaaggtggtcaat
gcatcgatcagcggcgacaccagtgcaggtggccaggcgcggctgccggcgctgcttgca
gcgcacaagccgagcctggtggtactggaactgggcggcaatgatggcctgcgtgggcag
ccgccagcgcaattgcaacaaaatcttgcctcgatgatcgagagctcgcgcaatgccggt
gccaaggtggtgctgctgggcatgcgcctgccacccaattatggcgtgcgctacaccacc
gccttcgcccaggtgtatgaacagctggcggcagaaaaacaggtcccgctggtgccgttt
ttcctcgagggggtagggggcgtgcctgagttgatgcaggcggatggcattcacccggcc
caggctgcccagcagcgcctgctggaaaatgcctggccggcgataaaacccttgctgtga

DBGET integrated database retrieval system