KEGG   Pseudomonas putida S16: PPS_2043Help
Entry
PPS_2043          CDS       T01570                                 

Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ppt  Pseudomonas putida S16
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppt00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppt00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ppt00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2281542..2282450
Genome map
AA seq 302 aa AA seqDB search
MQTLLNEILEEVRPLIGKGKVADYIPALADVPANQLGIAVYGNDGSYYCAGDALVPFSVQ
SISKVFSLVQAIGHSGEAIWQRLGHEPSGQPFNSLVQLEFERGRPRNPFINAGALVICDI
NQSRFAAPTLSMRDFVRRLSGNPHISIDARVADSEYQFRARNAAMAYLMQSFGNFHNEVE
TVLRSYFSYCALQMNCLDLARAFCFLANDGFCKHSGEQILTRRQTQQVNSIMATSGLYDE
AGNFAYRVGLPGKSGVGGGIVAIVPGQFTVCVWSPELNAAGNSLAGMAALELLSSRIGWS
VF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgctgttgaacgagattctcgaagaagtacgtcccttgatcggcaagggcaaa
gtggctgactacattcccgcgctggccgatgtgccggcgaaccagctgggcatcgcggtc
tatggcaacgatggcagctattactgtgcaggcgacgcgctggtgccgttctcggtgcag
agtatttccaaggtgttcagcctggtgcaggcgattgggcactccggggaagccatttgg
cagcggcttggccatgagccttccggccagccgttcaactcgctggtgcagctggagttc
gaacgcggtcggccgcgcaacccctttatcaatgcgggtgcgttggtgatctgcgacatc
aaccagtcgcgcttcgctgcacctacgttgtcgatgcgcgatttcgtgcggcggctatcg
ggcaatccgcacatctcgatcgatgcccgcgttgccgactcggagtatcagttccgtgcg
cgtaacgcggccatggcttacctgatgcagtcgttcggcaacttccataacgaggtggaa
acggtactgcgcagctatttcagctattgcgcgctgcagatgaattgcctggacctggcc
cgggcgttctgtttcctggctaacgatgggttctgcaagcacagtggtgagcagattctg
acccggcgccagacccagcaggtgaactcgatcatggccactagcgggttgtatgacgaa
gcagggaatttcgcctatcgggtagggttgccgggcaagagtggcgtggggggcgggatt
gtggccatcgtgccggggcaattcactgtgtgcgtgtggtcaccggagttgaatgcggcg
ggtaactcgctggccgggatggcggcgctcgaactgctcagttcgcggatcggctggtcg
gtgttctga

DBGET integrated database retrieval system