KEGG   Pseudomonas putida S16: PPS_2577Help
Entry
PPS_2577          CDS       T01570                                 

Definition
(GenBank) magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00860  Porphyrin and chlorophyll metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PPS_2577
Enzymes [BR:ppt01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PPS_2577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase MCM Sigma54_activat AAA AAA_16 AAA_3 AAA_33 Sigma54_activ_2
Motif
Other DBs
NCBI-ProteinID: AEJ13132
UniProt: F8FTI1
Position
2874306..2875316
Genome map
AA seq 336 aa AA seqDB search
MQFPLAAVVGADDLKLALCLTAIDPKIGGVLIEGPRGMAKSTLARGLADLLGEGPFVTLP
LGASEERLVGTLDLDAALGQGKAQFSPGVLAQADGGVLYVDEVNLLPDTLVDLLLDVAAS
GTNRIERDGISHRHSARFVLIGTMNPEEGELRPQLLDRFGLNVALEGLPEPEARQQIIRR
RLAFDSDPQAFCAQWAEAQAQLRERCQAARQALAGIALDDQALAWITERCYAAGVDGLRA
DLVWLRAARAHCAWRGGEAIEEADVDAVAEFALRHRRRVSPQANPPAAPQQPEQQPGRQD
AGNPGEQGGQGDWGAMPAQPVASGARREVPNWAKKP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgcaatttccactggcagccgtggtcggtgccgatgacctgaaactggcgctgtgcctg
accgcaatcgacccgaagatcggcggcgtgctgatcgaggggccacgtggcatggccaag
agtactctggcccgtggcttggccgacctgctcggtgagggcccgttcgtgaccctgcca
ctgggcgccagcgaagagcggctggtcggcaccctcgacctggatgccgcactggggcag
ggcaaggcgcagttctccccaggggtactggcccaggccgatggtggcgtgctgtatgtc
gatgaggtcaacctgctgcccgacaccctcgtcgacctgttgctcgatgtggcggccagt
ggcaccaaccgtatcgagcgcgacggcatctcgcaccggcacagtgcccgcttcgtactg
atcggcaccatgaacccggaggagggcgaactccgcccgcagttgctcgaccgctttggc
ctcaatgtggctctggaaggcttgcccgaacctgaggcgcgccaacagatcattcgccgc
cgtctggccttcgacagcgacccgcaggccttttgcgcgcaatgggccgaggcccaggcg
caattgcgcgagcgctgccaggcggcgcgtcaggccctggccggcattgccctggacgac
caggcactggcctggatcaccgaacgctgctatgccgctggggtcgacgggttgcgcgcc
gatctggtctggctgcgcgccgcacgcgcccactgtgcgtggcgtggtggcgaggccatc
gaggaggccgatgtcgatgcagtggccgagttcgccttgcgccatcgccgccgcgtttcg
ccccaggccaacccgcctgcggcgccgcagcagcctgaacagcaacccggtcgacaagac
gcgggcaaccctggcgaacagggcgggcagggcgactggggcgcaatgccggcgcagcct
gtggccagcggcgctcgccgcgaggtgccgaactgggcaaaaaagccctga

DBGET integrated database retrieval system