KEGG   Pseudomonas putida S16: PPS_2588Help
Entry
PPS_2588          CDS       T01570                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ppt  Pseudomonas putida S16
Brite
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PPS_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2886138..2887040
Genome map
AA seq 300 aa AA seqDB search
MLAQSIGGPLTPLPAVPELDPARVELGRKLFNDSRLSLDSSQSCADCHRLDRGGADGQAR
SLGADGKPLPVHTPSVFNASLNFLQFWDGRAQSFDGLVHLATGNTDGKEDGWATAVQRIA
DDPAYQTGFAEAYGKPVTTIDVKDALVTYQRTLLTPDSRFDRYLKGDTSSLSLEEKHGYQ
RFQEYGCIACHQGVNIGGNMLQKFGVFDDYFANRGNVTGADRGRYNVTGDPDDLHLFKVP
SLRNVEVTAPYFHDGSAPTLEAAVDAMFHYQLGRTPSDDDKALIIKFLQTLTGQWEGKPL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtgctggcccagagcatcggtgggccgctcacgccattgccggcggtgcctgagcttgac
cctgcccgggtggaactggggcgcaaactgttcaatgactcgcgtttgtccctcgatagc
agccagtcctgtgcagattgccatcgcctggatcgtggtggcgcggacgggcaggcgcgc
tcgcttggtgcagatggcaaacccttgccagttcacacccccagcgtcttcaacgccagc
ctgaacttcctgcagttctgggatgggcgcgcgcaatcgtttgacggcctggtgcacctg
gcaaccggtaatacggacggcaaagaagatggctgggctaccgcggttcaacgaattgct
gacgatccggcttaccagacggggttcgccgaagcctatggcaagccggtgaccaccatt
gatgtcaaagatgccctggttacgtaccagcgcaccctgctgacacccgattcacgcttc
gatcgctatctgaaaggagataccagcagcctcagcctggaagagaagcatggctatcag
cgcttccaggagtacggttgtatagcctgccaccagggtgtgaatatcggcggcaacatg
ctgcagaagttcggcgtcttcgatgattatttcgccaaccgtggcaatgttaccggggca
gatcggggacgctacaacgtgacaggtgacccggacgacctacacctgttcaaagttcca
agcctgcgaaacgtggaggtgactgccccttactttcatgacggttcggcgcccaccttg
gaagcagccgtcgatgccatgtttcattatcagttgggacgtacgccgagcgacgatgat
aaagcgctgatcatcaagtttctccagaccctcaccggccaatgggagggtaaaccgcta
tga

DBGET integrated database retrieval system