KEGG   Pseudomonas putida S16: PPS_2704Help
Entry
PPS_2704          CDS       T01570                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
ppt  Pseudomonas putida S16
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppt02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ppt02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2998073..3001855
Genome map
AA seq 1260 aa AA seqDB search
MKSSPKQPASPQNPALSPSHLDFPVVGIGASAGGLEAICTLFRQMPSDCGMAFVVVLHLS
PDHQSVADRIIQETTQMPVRQVTEPVPIERNHIYVISPANRLSTNDGYLRVTPANRRRGD
HVAIDLFFRDLADVHKDHAFCVVLSGTGADGAVGLSRIKEQGGVTLAQTPDDAQYDSMPR
AAIETGMVDLVLPAAEMPQKLLELWRNARQVRLPEIEDDTLPPALGTRVGDAQASEPMLE
EILLQLRSNTGHDFQHYKRATVLRRIERRLHVTGQADLAAYLHYLEQHPAESRALLADML
IGVTNFFRDREAFEALERHVLPQLVCERDPAEGADEIRVWSAGCSTGEEAYSLAMLVCEQ
LALEQRSHKVQVFATDLDERAIGIARSGSYPEAIVTDVPPSRLRQFFLKEDQHYRVRKEV
REKVLFARHNLLSDPPFSQIDLIVCRNLLIYLDREVQRDILQMFHFALRPGGYLFLGSSE
SADMASELFAPVDKRNRIFRALDASNTGRRSGRQLAGTSAASMPLETLAKAKPGRKPSFA
DLHYRALARRMPPSLIVDIDGNILHMSEGAGRFLQLAGGEPSRSLLSLVLPPLRLALRST
LFQARQGTEAVTSRPVDLAETMGKLQVEITVQPYKDDLSASDCLLVVFEERAPDPSLPLP
GVIRQTDSMVLHNLERELQRTRLQLQETIEQSEVSSEELTASNEEMQAINEELRSASEEL
ETSKEELQSINEELLTVNYELKNKVEETDKVNDYLSNLIACTEIATVFVDRNLHIRWFTP
RATDLFNMLPVDTGRSLLDITHRLDYPALADDARAVAQGEAIIEREIGGQGDHWYLARLL
PYRSSEQKIDGTVLTFIDISSSHAAEERVRLGEERLSKQLAETQSNNHMKDEFFAVMSHE
LKHPLNLIQLNAEILRRLPSLRNISAASKAVGTICDAVTSQARIIDDLLDVARIRTGKLK
LKTAPVDLLALLQGIHDVVVSEQHPCPVRLELPADTLPVMIEGDVTRLEQIIWNLLNNAL
KFSPAGNEIRLVLSHDEDHARLQVIDHGVGLSHDSLEHIFDLFSQATPQQGSHSREGLGI
GLSLVRQLVEAHGGTVRAKSPGLGLGCTFEVTLPLCDTQLPQREQGSEPLSEGRLNGIRV
LLVDDSVEVLAVMQELLEMESATVNAFSKPREALDAAAGEEYDIILSDIGMPVMDGHALI
KALRGYVHLRHTPAIALTGYGASADQYKSRQSGFDRHLSKPVGYDELVEAIEALSGSVPY
NT seq 3783 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtcccccaagcaacctgcctcgccccagaacccggcactcagccccagccac
ctggatttcccggtggtgggcatcggtgcatcggcaggcggtctggaagcgatctgtacg
ctgttccggcaaatgcccagcgattgcggcatggccttcgtcgtggtcctgcacctgtcc
cccgaccaccagagcgtcgccgaccgcatcatccaggagaccacgcaaatgccggtgcgc
caggtgaccgagccggtgccgatcgagcgtaaccatatctacgtgatttcaccggccaat
cgcctgtccaccaacgacggctacctgcgggtgaccccggccaaccggcgccgtggcgac
cacgtggccatcgacctgttcttccgtgacctggctgacgtgcacaaggaccacgccttc
tgcgtggtgttgtccggtaccggtgccgatggcgccgtgggcctgtcgcggatcaaggag
caaggcggtgtgaccctggcgcagacaccggacgacgcccagtacgacagcatgccccgt
gccgccatcgagaccggcatggtcgacctggtgctgccggcggcagaaatgccgcagaag
ctgctggagctgtggcgcaatgcccgccaggtccggctcccggaaatcgaggacgacacc
ctgcctccggccttgggcacccgtgtcggcgatgcccaggccagcgagccgatgctcgaa
gagatcctgctgcagttgcgcagcaataccggccacgacttccagcactacaagcgcgcc
acggtactgcgacgcatcgagcgccgcctgcatgtgaccggccaggcagacctggcggcc
tacctgcattacctggaacagcacccagcggaatcccgggcgttgctggccgacatgctg
attggcgtgaccaatttcttccgcgaccgcgaagccttcgaagccctggagcgccatgtg
ctgccgcagctggtctgcgaacgcgacccggccgagggcgcagacgagatacgcgtgtgg
tcggccggctgctccaccggcgaagaggcgtacagcctggccatgctggtttgcgagcag
ctggcactggagcagcgctcgcacaaggtacaggtgttcgccaccgacctggacgaacgc
gccatcggcatcgcccgcagtggctcataccccgaggcgatcgtcaccgacgtgccgccc
agccggctgcgccagttcttcctcaaggaagaccagcattaccgggtgcgcaaagaggtt
cgcgaaaaggtgctgttcgcacggcacaacctgctgtcggacccaccgttctcgcagatc
gacctgattgtctgccgcaacctgctgatctacctggaccgcgaggtgcagcgtgacatc
ctgcagatgttccacttcgctctgcgcccgggtggctacctgttcctcgggtcgtccgag
tcggccgacatggccagtgaactgttcgccccggtggacaaacgcaaccgcattttccgc
gcactcgatgccagcaataccggccgccgttccggccgtcagctggccggcacatctgcc
gccagcatgccactggaaacgctggccaaggccaagccggggcgcaagccatccttcgcc
gacctgcactaccgcgctctggcgcgccgcatgccgcccagcctgatcgtcgatatcgac
ggcaatatcctgcacatgagcgaaggcgcagggcgtttcctgcaactggccggtggcgaa
ccgagccgcagcctgctcagcctggtgctgccgcccctgcgcctggccctgcgcagcacc
ttgttccaggcgcgtcaggggaccgaggcggtgacctcgcgccctgtcgacctggcggaa
accatgggcaaactgcaggtggagatcaccgtgcagccgtacaaggacgacctcagcgcc
agcgattgcctgctggtggtgttcgaggaacgcgcgcccgacccatccctgccgttgccc
ggcgtcatccgccagaccgacagcatggtgctgcacaacctcgaacgcgaactgcagcgc
actcgcctgcaactgcaggaaaccatcgagcagtcagaggtctccagcgaggagctgacg
gcttccaacgaagagatgcaggccatcaacgaggagttgcggtcggccagcgaagaactg
gaaaccagcaaggaagagctgcagtcgatcaacgaggaactgctcacggtcaactacgag
ctgaagaacaaggtcgaggaaaccgacaaggtcaacgactacctcagcaacctgatcgcc
tgcaccgagatcgccacggtgttcgtcgaccgcaacctgcatatccgctggttcaccccg
cgcgccaccgacctgttcaatatgctgccggtcgataccggccgttccctgctcgacatc
acccaccgcctggattacccggcgctggccgacgatgcccgcgccgtggcccagggcgag
gccatcatcgagcgtgaaatcggcggccagggcgatcactggtacctggcgcgcctgctg
ccctaccgctccagcgagcagaaaatcgacggcacggtgctgaccttcatcgacatcagc
agcagccatgccgccgaggagcgcgtgcgcctgggcgaagagcgcctgagcaagcagttg
gccgagacgcagagcaacaaccacatgaaggacgagttcttcgccgtcatgtcccatgag
ctcaagcacccgctcaacctgatccagctcaatgccgaaatcctgcgccgcctgccgtcg
ctgcgcaacatcagtgcagcgagcaaggccgtgggtaccatttgcgacgcggtaaccagc
caggcgcggatcatcgacgacctgctggatgtggcgcgcattcggaccggcaagcttaag
ctcaagaccgcacctgtggatctgctcgccctcctgcagggcatccatgatgtggtggtg
agcgagcaacacccctgcccggttcgcctggagctgcccgccgacaccctgccggtgatg
atcgaaggtgacgttacccgcctggagcagatcatctggaacctgctcaacaacgcgctg
aagttcagcccggcgggcaatgagatacgcctggtgctgagccacgacgaagaccacgcg
cggctgcaggtgatcgaccatggcgtaggcctgagccacgacagcctcgagcacatcttc
gacctgttcagccaggctacgccgcaacagggtagccacagccgcgagggcctgggcatc
ggtctgtcgctggtacggcaactggtcgaggcccatggcggtaccgtacgcgccaagtca
ccggggcttggcctgggctgcacctttgaggtcaccctgccactttgcgatacgcaactc
ccgcagcgtgagcaaggctcggagccactgagcgagggccgccttaatggaattcgcgtg
ttgctggtggacgattccgtagaagtgctggcggtaatgcaggagctgctggaaatggag
agcgccactgtcaatgccttcagcaagccacgtgaggccctggacgccgctgcgggtgag
gaatacgacatcatcctgtccgatatcggcatgccggtgatggacggccatgcgctgatc
aaggccctgcgtggctacgtgcacctgcgccataccccggccatcgccctgaccggctat
ggcgccagcgccgaccagtacaagtcccgccagtcgggcttcgaccggcacctgagcaag
ccggtgggctatgacgagctggtggaggccatcgaggcgctgagcggctcggtgccctac
tga

DBGET integrated database retrieval system