KEGG   Pseudomonas putida S16: PPS_2937Help
Entry
PPS_2937          CDS       T01570                                 

Definition
acyl-CoA synthetase
Orthology
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
ppt  Pseudomonas putida S16
Brite
Enzymes [BR:ppt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     PPS_2937
Lipid biosynthesis proteins [BR:ppt01004]
 Acyl-CoA synthetase
  Unknown
   PPS_2937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3285697..3287505)
Genome map
AA seq 602 aa AA seqDB search
MLLSSRVNPLLQGSPQGLNVLRSLWERVYPRRGPLNQHKNNKRPPMPQPSYSQGNQDKPL
LTQCIGDAFDTTVARFPDRDALVVRHQALRYTWQQLAEAVDQHARALMALGVQPGDRLGI
WAPNCAEWCITQFASAKVGAILVNINPAYRSSELDYALGQSGCRWVICADAFKTSDYHAM
LLGLVPGLASSQPGALICERFPELRGVVSLAVAPPAGFLAWHDLQARAAAVSREALAERQ
AQLRCDDPINIQYTSGTTGFPKGATLSHSNILNNGYMVGESLGLTEHDRLVVPVPLYHCF
GMVMANLGCMTHGSTLIYPNDAFDPLATLRAVAEEKATALYGVPTMFIAELDHPQRGEFD
LSSLRTGIMAGATCPIEVMRRVIGEMHMAEVQIAYGMTETSPVSLQTGASDDLERRVTSV
GRTQPRLENKVIDADGNTLPRGEIGELCTRGYSVMLGYWNNPKATAESIDEEGWMHTGDL
AVMDEQGYVRIVGRSKDMIIRGGENIYPRELEEFFFTHPAVADVQVIGVPCSKYGEEIVA
WVRLHPGHTASAEELRDWAKARIAHFKVPRYFRFVDEFPMTVTGKVQKFRMREISVEELS
AR
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
gtgttgctttcttcgcgggtaaacccgctcctacaaggatctccacaggggctgaatgtg
ctgcggtccctgtgggagcgggtttacccgcgaagaggcccgctcaatcaacacaagaac
aacaagagaccgcccatgccccagccaagctactcccagggcaaccaggacaaacccctg
cttacccagtgcatcggcgacgccttcgacaccaccgtcgcccgcttccccgaccgtgac
gcgctggtcgtccgccaccaggcactgcgctacacctggcagcaactggccgaagccgtc
gaccagcacgcccgtgcgctgatggccctgggcgtgcagcccggtgaccgcctcggcatc
tgggcacccaactgcgcagagtggtgcatcacccagttcgccagcgccaaggtgggcgcg
atcctggtcaacatcaacccggcctaccgctccagcgaactggactacgccctcggccag
tccggctgccgctgggtgatctgcgccgacgcgttcaagacatccgactatcacgccatg
ttgctgggcctggttccgggcctggccagcagccagccgggcgccctgatctgcgaacgc
ttccccgaactgcgcggtgtggtcagcctggccgtcgcgccaccggcgggctttctcgcc
tggcacgacctgcaggcccgtgccgcggccgtcagccgcgaagccttggccgagcgccag
gcacagctgcgctgcgacgacccgatcaatatccagtacacctcgggcaccaccggtttc
ccgaaaggcgccaccctcagccacagcaacatcctcaacaacggctacatggtcggtgaa
agcctgggcctgaccgagcatgaccggctggtggtgccggtgccgctgtaccactgcttc
ggcatggtcatggccaacctcggctgcatgacccacggcagcaccctgatctaccctaac
gacgccttcgacccgctggccaccctgcgtgcggtggcggaagaaaaggccacggcgttg
tatggtgtgccgaccatgttcatcgccgaactggaccacccccagcgcggcgagttcgac
ctgtccagcctgcgcaccgggatcatggccggtgccacctgcccgatcgaagtgatgcgc
cgggttatcggcgagatgcacatggccgaggtgcagattgcctacggcatgaccgaaacc
agcccggtgtcgctgcagaccggcgccagcgacgacctggagcgccgcgtgaccagcgtc
gggcgcacccagccaaggctggagaacaaggtgatcgatgctgatggcaacacgctgccg
cggggcgagatcggcgaattgtgcacgcggggttacagcgtgatgctgggctattggaac
aaccccaaggccacggctgaaagcatcgatgaggaaggctggatgcacaccggcgacctg
gcggtaatggacgagcagggctatgtgcgtattgtcgggcgcagcaaggacatgatcatt
cgcggcggcgagaacatctacccgcgcgagctggaggagttcttcttcacccacccggcg
gtggccgatgtgcaggtgattggcgtgccgtgcagcaagtacggtgaagagatcgtggcc
tgggtgcggctgcacccggggcatacggccagcgcggaggaactgcgcgattgggcgaag
gcgcggatcgcgcacttcaaggtgccgcggtacttccgctttgtcgatgagttcccgatg
acggtgaccggcaaggtgcagaagttccgcatgcgcgagatcagtgtcgaggagctgtct
gccaggtga

DBGET integrated database retrieval system