KEGG   Pseudomonas putida S16: PPS_3158Help
Entry
PPS_3158          CDS       T01570                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ppt  Pseudomonas putida S16
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ppt00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3547492..3548142
Genome map
AA seq 216 aa AA seqDB search
MKIASFDVDAQNGFTNNVPQELPVPEGDEIAVDLNTMALRADLRLGSKDAHPANAAWVVA
DPAHMLQPLQLANADLTWVSHCVPGTPGFELLPGLPAPIDYDYFVWKGVEPDLHPYGACY
HDLAERRSTGVIEYLKVQQVGAVIVGGLALDYCVRTTARQLRQAGFQVLLYLPACRALTQ
AGAIEACGALAAEGVILCGDEAALDYQLSLIKEDRP
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgccagtttcgatgtcgacgcccagaacggcttcaccaacaacgtgccacaa
gaactgccggttcctgaaggcgatgaaatcgcggtagatcttaataccatggcgttacgc
gccgacctgcgcctgggcagcaaggacgcccacccggccaacgccgcctgggtagtcgcc
gaccccgcgcacatgctgcagcccctgcagctggccaacgccgacctgacctgggtcagc
cactgcgtgcccggcacacccggcttcgagttgctgcccggcctgccggcccccatcgac
tatgactatttcgtatggaaaggcgtcgagcccgacctgcacccctacggcgcctgctac
cacgacctggccgaacgccgctccaccggggtgatcgagtacctcaaggtgcagcaggtg
ggcgcggtgatcgtcggtggcctggccctggactattgcgtcaggaccactgcgcgccaa
ttgcgccaggccggcttccaggtgctgttgtacctgccggcctgccgcgccctcacccag
gcaggcgccatcgaagcatgtggcgccctggccgccgagggcgtgatcctctgcggcgac
gaagccgcgctcgactaccagctctctctgatcaaggaagaccgcccatga

DBGET integrated database retrieval system