KEGG   Pseudomonas putida S16: PPS_3217Help
Entry
PPS_3217          CDS       T01570                                 

Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppt  Pseudomonas putida S16
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPS_3217
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPS_3217
   00630 Glyoxylate and dicarboxylate metabolism
    PPS_3217
Enzymes [BR:ppt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PPS_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3622127..3624298
Genome map
AA seq 723 aa AA seqDB search
MPNHPLQIAPTLQRFIEDEVLPGTGIEARTFWQGFSTLIHDLAPQNRALLAERERLQTEL
DNWHRRHPGPIRDMAAYQHFLQGIGYLVEPPASVQVSTRNVDREIAVQAGPQLVVPLSNA
RYALNAANARWGSLYDALYGTDAIAETEGAERGQGYNPQRGAKVIAYGRQFLDTAAPLDG
ASHSDAKAYAISQGTLQVTLADGRQVGLRHPAQLRGYQGEPNTPTAILLQHHQLHFEIQV
DPANAIGRQDPAGVKDILLEAALTTIIDCEDSVAAVDADDKVNVYRNWLGLMKGDLSEQV
SKGGKTFERTLAEDRHYHGADGQPLTLPGRSLLFIRNVGHLMTNPAIHDRDGREIPEGIL
DAVVTSLIGLHDLKRRGNSREGSLYIVKPKMHGPAEVAFADQLFGRVEALLGLPAHTLKM
GIMDEERRTSVNLKACIASAASRVVFINTGFLDRTGDEMHTAMEAGAMLRKGDMKGSAWI
QAYERSNVLVGLACGLRGKAQIGKGMWAMPDLMAAMLEQKVAQPRAGANTAWVPSPTAAT
LHALHYHQVDVAAVQQTLEQVDLNAQRAELLHDLLSVPVSPERPWSAAEIQAELDNNCQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISAQHIANWLHHGVVDAEQVEATLQR
MAGVVDQQNAGDPAYRPMAAGFEASHAFRAARELVFKGRQQPSGYTEPLLHGWRLRFKQE
VGR
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaccatccactccagatcgcccccaccctgcagcgcttcatcgaagatgaggtc
ctccccggcaccggcatcgaagcccgcaccttctggcaaggcttcagcaccctgatccac
gacctcgcaccacaaaaccgcgccctgctcgccgaacgcgagcgcctgcagacagaactc
gacaactggcaccgccggcaccccggcccgatccgtgacatggccgcctaccagcatttc
ctgcaaggcatcggctaccttgtagagcccccggcaagcgtgcaggtcagcacccgcaac
gttgaccgcgagatcgccgtgcaggccggcccgcaactggtggtgccactgagcaacgcc
cgctacgctctcaacgccgccaacgcccgctggggctcgctgtacgatgccctgtatggc
accgatgccatcgccgaaaccgagggcgccgagcgtggccagggctacaacccgcaacgc
ggcgccaaggtgatcgcctatggccggcagttcctcgacaccgcggcccctctcgacggt
gcgtcgcacagcgacgccaaggcctacgcgatcagccagggcacgctgcaggtaaccctg
gccgatggccgccaggtcggcctcaggcaccccgcgcaactgcgtggttaccaaggtgag
ccgaacacgccaacagcgatcctgttgcagcatcaccaattgcatttcgaaatccaggtc
gacccagccaacgccatcggccggcaggacccggccggggtcaaggacatcctgctggag
gccgcgctcaccaccatcatcgactgcgaagactcggtagccgccgtggacgccgacgac
aaggtcaacgtctaccgcaactggctcggcctgatgaagggcgacctcagcgaacaggtc
agcaagggcggcaagaccttcgaacgcaccttggccgaagaccgccactaccacggcgca
gacggccagcccctgaccctgccgggccgctcgctgctgttcatccgcaacgtcggccac
ctgatgaccaacccggctatccacgaccgtgatggccgggaaatcccggaaggcatcctc
gatgccgtggtcaccagcctgatcggcctgcatgacctcaagcgccgtggcaattcccgc
gagggcagcctgtacatcgtcaagccgaagatgcacgggccggccgaggtggcctttgcc
gaccagctgttcggccgcgtcgaagccctgttgggcctgcccgcacacacgctgaagatg
ggcatcatggacgaggagcggcgtaccagcgtcaacctcaaagcctgcatcgccagcgcc
gcgtcacgggtggtgttcatcaacaccggcttcctcgaccgcaccggtgacgagatgcac
acggccatggaagccggcgccatgctgcgcaagggtgacatgaaaggcagtgcctggatc
caggcctacgagcgcagcaacgtactggtggggctggcctgtggcctgcgcggcaaggcg
cagatcggcaagggcatgtgggccatgcccgacctgatggcggccatgctggaacagaaa
gtcgcccagcccagggccggcgccaacacggcctgggtgccctcgcccacagccgcgaca
ctgcatgcgctgcactaccaccaggtggatgtggcggccgtgcagcaaacgctggaacag
gttgacctgaatgcccagcgcgccgagttgctgcatgacctgctcagtgtcccggtcagc
cccgagcggccctggagcgcagccgaaatccaggccgagctggacaacaactgccagggt
atcctcggttacgtggtgcgctgggtcgagcaaggggtcggctgttccaaggtgccggat
atccatgatgtgggcctgatggaagaccgcgcgaccctgcggatttcggcgcagcacatt
gccaactggctgcaccacggggtggtcgatgccgagcaggtcgaagcgactttgcaacgc
atggccggcgtggtcgaccagcagaatgccggggacccggcgtaccggccgatggccgcc
ggtttcgaggcatcgcatgccttccgcgctgcgcgggagctggtgttcaaggggcggcag
cagcccagtggctataccgaaccgttactgcatggctggcgcttgcgtttcaagcaggag
gttgggcgctga

DBGET integrated database retrieval system