KEGG   Pseudomonas putida S16: PPS_3217Help
Entry
PPS_3217          CDS       T01570                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ppt  Pseudomonas putida S16
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPS_3217
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPS_3217
   00630 Glyoxylate and dicarboxylate metabolism
    PPS_3217
Enzymes [BR:ppt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PPS_3217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3622127..3624298
Genome map
AA seq 723 aa AA seqDB search
MPNHPLQIAPTLQRFIEDEVLPGTGIEARTFWQGFSTLIHDLAPQNRALLAERERLQTEL
DNWHRRHPGPIRDMAAYQHFLQGIGYLVEPPASVQVSTRNVDREIAVQAGPQLVVPLSNA
RYALNAANARWGSLYDALYGTDAIAETEGAERGQGYNPQRGAKVIAYGRQFLDTAAPLDG
ASHSDAKAYAISQGTLQVTLADGRQVGLRHPAQLRGYQGEPNTPTAILLQHHQLHFEIQV
DPANAIGRQDPAGVKDILLEAALTTIIDCEDSVAAVDADDKVNVYRNWLGLMKGDLSEQV
SKGGKTFERTLAEDRHYHGADGQPLTLPGRSLLFIRNVGHLMTNPAIHDRDGREIPEGIL
DAVVTSLIGLHDLKRRGNSREGSLYIVKPKMHGPAEVAFADQLFGRVEALLGLPAHTLKM
GIMDEERRTSVNLKACIASAASRVVFINTGFLDRTGDEMHTAMEAGAMLRKGDMKGSAWI
QAYERSNVLVGLACGLRGKAQIGKGMWAMPDLMAAMLEQKVAQPRAGANTAWVPSPTAAT
LHALHYHQVDVAAVQQTLEQVDLNAQRAELLHDLLSVPVSPERPWSAAEIQAELDNNCQG
ILGYVVRWVEQGVGCSKVPDIHDVGLMEDRATLRISAQHIANWLHHGVVDAEQVEATLQR
MAGVVDQQNAGDPAYRPMAAGFEASHAFRAARELVFKGRQQPSGYTEPLLHGWRLRFKQE
VGR
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaccatccactccagatcgcccccaccctgcagcgcttcatcgaagatgaggtc
ctccccggcaccggcatcgaagcccgcaccttctggcaaggcttcagcaccctgatccac
gacctcgcaccacaaaaccgcgccctgctcgccgaacgcgagcgcctgcagacagaactc
gacaactggcaccgccggcaccccggcccgatccgtgacatggccgcctaccagcatttc
ctgcaaggcatcggctaccttgtagagcccccggcaagcgtgcaggtcagcacccgcaac
gttgaccgcgagatcgccgtgcaggccggcccgcaactggtggtgccactgagcaacgcc
cgctacgctctcaacgccgccaacgcccgctggggctcgctgtacgatgccctgtatggc
accgatgccatcgccgaaaccgagggcgccgagcgtggccagggctacaacccgcaacgc
ggcgccaaggtgatcgcctatggccggcagttcctcgacaccgcggcccctctcgacggt
gcgtcgcacagcgacgccaaggcctacgcgatcagccagggcacgctgcaggtaaccctg
gccgatggccgccaggtcggcctcaggcaccccgcgcaactgcgtggttaccaaggtgag
ccgaacacgccaacagcgatcctgttgcagcatcaccaattgcatttcgaaatccaggtc
gacccagccaacgccatcggccggcaggacccggccggggtcaaggacatcctgctggag
gccgcgctcaccaccatcatcgactgcgaagactcggtagccgccgtggacgccgacgac
aaggtcaacgtctaccgcaactggctcggcctgatgaagggcgacctcagcgaacaggtc
agcaagggcggcaagaccttcgaacgcaccttggccgaagaccgccactaccacggcgca
gacggccagcccctgaccctgccgggccgctcgctgctgttcatccgcaacgtcggccac
ctgatgaccaacccggctatccacgaccgtgatggccgggaaatcccggaaggcatcctc
gatgccgtggtcaccagcctgatcggcctgcatgacctcaagcgccgtggcaattcccgc
gagggcagcctgtacatcgtcaagccgaagatgcacgggccggccgaggtggcctttgcc
gaccagctgttcggccgcgtcgaagccctgttgggcctgcccgcacacacgctgaagatg
ggcatcatggacgaggagcggcgtaccagcgtcaacctcaaagcctgcatcgccagcgcc
gcgtcacgggtggtgttcatcaacaccggcttcctcgaccgcaccggtgacgagatgcac
acggccatggaagccggcgccatgctgcgcaagggtgacatgaaaggcagtgcctggatc
caggcctacgagcgcagcaacgtactggtggggctggcctgtggcctgcgcggcaaggcg
cagatcggcaagggcatgtgggccatgcccgacctgatggcggccatgctggaacagaaa
gtcgcccagcccagggccggcgccaacacggcctgggtgccctcgcccacagccgcgaca
ctgcatgcgctgcactaccaccaggtggatgtggcggccgtgcagcaaacgctggaacag
gttgacctgaatgcccagcgcgccgagttgctgcatgacctgctcagtgtcccggtcagc
cccgagcggccctggagcgcagccgaaatccaggccgagctggacaacaactgccagggt
atcctcggttacgtggtgcgctgggtcgagcaaggggtcggctgttccaaggtgccggat
atccatgatgtgggcctgatggaagaccgcgcgaccctgcggatttcggcgcagcacatt
gccaactggctgcaccacggggtggtcgatgccgagcaggtcgaagcgactttgcaacgc
atggccggcgtggtcgaccagcagaatgccggggacccggcgtaccggccgatggccgcc
ggtttcgaggcatcgcatgccttccgcgctgcgcgggagctggtgttcaaggggcggcag
cagcccagtggctataccgaaccgttactgcatggctggcgcttgcgtttcaagcaggag
gttgggcgctga

DBGET integrated database retrieval system