KEGG   Pseudomonas putida S16: PPS_3378Help
Entry
PPS_3378          CDS       T01570                                 

Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00620  Pyruvate metabolism
ppt00630  Glyoxylate and dicarboxylate metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01200  Carbon metabolism
Module
ppt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PPS_3378
   00630 Glyoxylate and dicarboxylate metabolism
    PPS_3378
Enzymes [BR:ppt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PPS_3378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEJ13925
UniProt: F8G5M6
Position
3788109..3790286
Genome map
AA seq 725 aa AA seqDB search
MTKRVPCQRLQVAETLKNFIEQEVLPGTNVSSDDFWKGLDTLVHDLAPQNRALLLERDRI
QAQLDEWHRGNPGPIQNMEAYIGFLTSIGYLVPQPEHVGVTTENVDNEITSQAAPQLVVP
VMNARYALNAANARWGSLYDALYGTDVISDDDGAKKSSSYNPKRGSKVVAYARSFLDQAF
PLVSASHVDAVAYQVVDDKLTVGLADGTSTTLANEDQFIGHNGRADFPTVVLLKNNGLHV
EIQIDPSSSIGMSDKAGVQDLLLESAVTTIMDCEDSVAAVDADDKVLVYRNWLGLMKGDL
TETVTKGGNSFTRTLSLDRTYQGRNGSRITLPGRSLLFVRNVGHLMTNPAILDGEGNEIP
EGILDAVITSLAAVHDLNRKGNSRTGSIYIVKPKMHGPKEVAFANTLFGRVEDLIGVPRH
TIKMGIMDEERRTTANLKACIAEASHRVVFINTGFLDRTGDEMHSTMEAGAMLRKGDMKS
TPWIRAYERNNVLVGLSSGLRGRAQIGKGMWAMPDLMSAMLEQKIGHPKAGANTAWVPSP
TAATLHAIHYHQVDVQAVQSELEKVDLNHERAGLLHDLLSVPVSVERNWAAWDIQSELDN
NCQSILGYVVRWVEQGVGCSKVPDIHNVGLMEDRATLRISAQHIANWLYHGVVTSAQVSE
TLQRMARVVDQQNAHDPAYRAMTTSFSDSHAFRAASDLIFKGREQPSGYTEPLLHAWRLR
FKQQR
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgactaagcgtgtgccctgccagcgtctgcaagtagcagaaaccctcaaaaacttcatt
gagcaagaggttctgccgggaaccaatgtgtcctccgatgacttctggaaaggccttgac
acccttgtgcatgacctagcacctcagaaccgcgcccttttgctcgaaagggatcgaatc
caagctcagcttgatgagtggcaccgcggaaatccaggcccgatccagaatatggaagcc
tatattggctttctgacctccattggttacctcgtgcctcaaccagagcacgtgggtgtt
acaactgagaacgtcgataacgaaatcacatctcaggccgctccacagcttgtggtgcca
gtgatgaacgctcgctatgcgctcaacgctgcgaacgctcgctggggatcattgtacgac
gccctttatggcacggatgtgatcagtgacgacgatggtgccaagaagtcttcaagctac
aaccctaagcgtggtagcaaggttgttgcctacgctcgctcgttcctcgatcaagctttt
cctctggtatctgcatcccatgtggatgccgtcgcataccaggtggtggatgacaaactg
acggtcgggttggccgatggaacatccactaccttggctaatgaagaccaattcataggc
cacaatggacgggcagatttccccacggttgtgctcctaaaaaacaacggccttcacgtt
gaaattcagattgacccgagcagctccatcgggatgtcggataaagccggcgttcaggat
ttgctgttggagtccgcagtgacaacgatcatggactgcgaagattcggtggccgcggta
gacgcagacgacaaagtcttggtctatcgcaactggctaggtctgatgaaaggagatctc
actgaaaccgtaaccaaaggtgggaattccttcaccaggactttgagccttgaccgcacc
taccagggacgaaatggcagccgaatcactctgcctgggcggtcgcttctgttcgtccgc
aacgtcggccacctcatgaccaatcccgccatcctcgatggcgagggcaatgagatccca
gaaggcatccttgatgccgtgatcaccagcctggcggcagttcacgatctaaaccggaaa
ggcaattctcgtactggaagcatctacatcgtgaagcccaagatgcatggcccgaaagag
gtcgctttcgcaaacacgcttttcgggcgtgttgaggatctcatcggcgtcccacggcat
acgatcaaaatgggcatcatggatgaagagcggcgcaccactgccaacctcaaggcgtgt
atagctgaggcctcacatcgcgtcgtgttcattaacactggcttcctagatcgtacaggt
gatgagatgcactccacgatggaggccggcgccatgcttcgcaaaggcgacatgaagagc
actccgtggatccgagcctacgaacggaacaacgtcttagtcgggctttccagtggcctg
cgcggtcgagctcaaatcggtaagggcatgtgggcaatgcctgacctgatgtcagcaatg
ctggaacaaaagattggtcatccaaaagcaggtgccaatacggcctgggtaccctcccca
acagccgcgaccttgcacgcgattcactaccaccaggttgatgtgcaggcagtacaaagc
gagcttgagaaggtagacctgaatcacgaacgagctgggctcctacatgacttgctgtct
gtacctgtgagcgtggagaggaattgggctgcctgggacatccagtccgagttggacaac
aattgccagagcattttgggctacgtagttcggtgggttgaacagggagttggctgctcc
aaggttcctgacattcacaacgtgggcttgatggaggatcgcgccacacttcgaatctcc
gcccagcacattgccaactggctctatcacggcgtggtgacaagcgcgcaagtgagcgag
acccttcaacgcatggcccgcgtggttgatcaacagaacgcacatgacccggcttaccgg
gcaatgacaacatcattcagtgattcgcatgcattccgtgcggcctctgatctgatcttc
aaaggacgtgaacaacccagtggctacaccgagccgctgcttcacgcctggcgcctgcgc
ttcaaacagcaacgctaa

DBGET integrated database retrieval system