KEGG   Pseudomonas putida S16: PPS_3457Help
Entry
PPS_3457          CDS       T01570                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ppt  Pseudomonas putida S16
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPS_3457
Enzymes [BR:ppt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PPS_3457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3888563..3890632
Genome map
AA seq 689 aa AA seqDB search
MSETALHRLASRVGLSRDWIDANARPQRVSDEVLRNILEGLGHPANDDAAIAASLRAVDA
AEDSEHLPPLLTADLGQPLALARYFSAASVAHCTLEDHSALTLSLDDQARLPGALPIGYH
QVEIDSRRFTVAVAPLRCHSLEDRVQQPPPRCWGLAVQLYSLRRPGDGGYGDCLALEQLA
RAAAERGADALAISPIHALSALDQTHYSPYSPSSRLLLNTLYASPAALLGEREVRVAIEA
CGLEQQLEDLEQGPLVDWPRAASARQRLLEALYQGFSQGDHPLRKDFDSFRKAGGQALEH
HCRFEVLQAQAVEHGLGADWRHWPKAWHDPYHPEVEAFANAYPAKVEFHAFCQWLTERGL
QRAQEAARGNGMAVGLIADLAVGADGAGSQAWSRQDELLAGLKVGAPPDILNRAGQDWGI
CAFSPEGLKRNGYRAFIEMLRANLAHAGGLRIDHVMGLRRLWLIPQGAKPSEGAYLNYPL
EDLLRLLALESVRHQAIILGEDLGTVPDGLREQLAAKAVLGMRVLPFEQTQPGHFKPILD
WPDNALATTGTHDLAPLAGWLENRDIDWSHRLQLIDAATELHWRHERQKEHDGLRRTLEA
NYGTLPNNDALIDAAIRYVGHTRAPLVLVPLEDLLGCDEQPNLPGTTSGHPNWRRRFARP
VRELLDDEDAARRLELLAQAREQAWERDR
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaccgccctgcaccgtctggcgagccgcgtcgggctgagccgcgactggatc
gacgccaatgcccggccccagcgtgtcagcgacgaggtactgcgcaacatacttgaaggc
cttggccaccctgccaacgatgacgccgccatcgccgccagcctgcgcgccgtggacgct
gccgaagacagtgagcacctgccgccgctgctgaccgccgacctaggccagccattggca
ctggcgcgctacttcagcgccgccagcgtcgcgcactgcaccctggaggaccacagcgcc
ctcaccctcagccttgacgaccaggcccgcctgcccggcgcgctacccatcggctaccac
caggtggaaatcgacagccgccgcttcaccgtggccgtggccccgctgcgctgccacagc
cttgaagaccgggtgcaacagccgccaccgcgctgctggggcctggcggtgcagctgtac
agcttgcgccgccccggcgatggcggctatggcgactgcctggccctggaacaactggcc
cgcgcggctgccgaacgcggcgccgatgccttggccatcagcccgatccacgccctgtcg
gccctcgaccagacgcactacagcccctactcgccttccagccgcctgctgctcaatacc
ctgtacgccagcccagccgcgctgctgggcgagcgggaggtgcgcgtggccatcgaagcc
tgcggcctggagcaacagctcgaagaccttgagcaaggcccgctggtagactggccacgt
gccgccagcgcccgacagcgcctgctcgaagccctgtaccagggcttcagccagggcgac
cacccgctacgcaaggacttcgacagtttccgcaaagccggtggccaggcgctggagcac
cattgccgcttcgaagtgctgcaggcgcaagccgtggagcatggcctgggcgccgactgg
cgccactggcccaaggcctggcacgacccataccacccggaagtggaggccttcgccaac
gcctacccggccaaggtcgagttccatgccttctgccaatggctgaccgaacggggcctg
caacgcgcccaggaagcagcgcgcggcaacggcatggcggtcggcctgatcgctgacctg
gcggtgggcgccgacggtgccggcagccaggcctggagccgccaggacgagctgctggca
ggcctgaaggtaggcgcaccgcccgacatcctcaaccgtgccggccaggactggggcatc
tgcgccttctcgcccgaaggcctcaagcgcaacggctaccgcgccttcatcgaaatgctc
cgggccaacctcgcccacgccggcggcctgcgcatcgaccatgtcatgggcctgcgccgg
ctgtggctgatcccgcagggggccaagcccagcgaaggcgcctacctcaactacccgctg
gaagatctgttacgcctgctggccctggagtcggtgcgccaccaggcaatcatcctcggc
gaagacctgggcaccgtgccggacggcctgcgcgagcaactggcagccaaggccgtgctg
ggcatgcgcgtgctgcccttcgagcagacccagcccggccatttcaagccgattctcgac
tggccggacaacgccctggccaccaccggcacccacgacctggcgccgctggccggctgg
ctggaaaaccgcgacatcgactggagccaccgcctgcaactgatcgatgctgccaccgaa
ctgcactggcgccacgagcggcagaaggagcacgatggtttgcgccgcaccctggaggcc
aactacggcacgctgccgaacaacgacgcgctgatcgacgctgccatccgttacgttggc
cacacccgcgcaccgctggtgctggtgccattggaagacctgctgggttgtgacgagcaa
cccaacctgccgggcaccacctccggccaccccaactggcgccgacgctttgcccggccg
gtacgtgaactgctcgacgacgaagacgctgcgcggcgcctggaactgctggcccaggcc
cgcgaacaggcttgggagcgtgaccgatga

DBGET integrated database retrieval system