KEGG   Pseudomonas putida S16: PPS_3463Help
Entry
PPS_3463          CDS       T01570                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppt  Pseudomonas putida S16
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPS_3463
Enzymes [BR:ppt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PPS_3463
Exosome [BR:ppt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPS_3463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3898456..3900666)
Genome map
AA seq 736 aa AA seqDB search
MNATTRENGGLRQRDLDALARAEHADPFAVLGPHGDGAGGQVVRAFLPNALNVRILARHD
GRILAEMEQGSLPGLFTAHLDEAHPYLLQIGWAGGEQITEDPYSFGPQLGDMDLYLFAEG
NHRDLSGRFGAQPIQVDGVDGVCFSVWAPNARRVSVVGDFNNWDGRRHPMRLRHSAGVWE
LFVPRLGVGETYKFEVLGKDGILPLKADPLARATELPPSTASKVAGALSHDWQDHDWMAQ
RAQRHAYSAPLSIYELHPGSWRCELDEAGEVGRYYNWRELAERLVPYVQELGFTHIELLP
IMEHPFGGSWGYQPLSLFAPTSRYGSAEDFAAFIDACHQGGIGVLLDWVPAHFPTDEHGL
ARFDGTALYEYDNPLEGYHQDWNTLIYNLGRNEVRGFMMASALHWLKHFHIDGLRVDAVA
SMLYRDYSRKAGEWVPNRHGGRENLEAIDFIRHLNGVAAHEAPGALIIAEESTAWPGVSQ
PTQQGGLGFAYKWNMGWMHDTLHYIQNDPVHRTYHHNEMSFGLIYAYSEHFILPISHDEV
VHGKHSLIDKMPGDRWQKFANLRAYLTFMWAHPGKKLLFMGCEFGQWREWDHDGELDWYL
LQYPEHQGVQRLVGDLNRLYREVPALHEQDCQPQGFQWLIGDDAQNSVYAWLRWSSSGEP
VLVVANFTPVPREGYRIGVPFGERWQELLNSDAELYAGSNVGNLGVVESDQIASHGQPQS
LALNLPPLGVLIMKPA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaaccacgcgtgaaaacggcggccttcggcaacgggacctcgacgccctggcc
cgcgccgagcacgccgatccatttgcggtactcggcccccatggcgatggcgccggcggg
caggtggtccgcgccttcctgcccaacgccctgaatgtgcgcatccttgcccggcatgac
gggcgcatcctcgccgaaatggagcagggcagcctgccagggctgttcaccgcgcacctc
gatgaggcacacccgtacctgctgcagatcggttgggccggtggcgagcagattaccgaa
gacccctacagcttcggcccgcaactgggcgacatggacctgtacctgttcgccgaaggc
aaccaccgcgacctgtccgggcgcttcggcgcccaacccatccaggtcgatggcgtcgat
ggcgtgtgtttctcggtgtgggcaccgaacgcccggcgggtgtcggtggtgggtgacttc
aacaactgggatggccgccgccaccccatgcgcctgcgccacagcgccggggtgtgggag
ctgttcgtgccgcgcctgggcgtgggcgaaacctacaagttcgaggtgctgggcaaggac
ggcatactgcccctgaaggccgacccgctggcgcgcgccactgaactgccgccgagcacc
gcatccaaggtggcaggggcgctcagccacgactggcaagaccacgactggatggcgcaa
cgcgcgcaacgccatgcctacagcgcgccgctgtcgatctacgaactgcacccggggtcg
tggcgctgcgagctggatgaggcgggcgaggtcgggcgctattacaactggcgcgagctg
gccgagcgcctggtgccgtacgttcaggaactgggcttcacccacatcgaactgctgccg
atcatggagcacccgttcggcggctcctggggctaccagccgctgtcgctgttcgccccc
acctcgcgctacggcagcgccgaggacttcgccgcgttcatcgacgcctgccaccaaggg
ggcattggtgtactgctggactgggtaccggcgcatttccccaccgacgaacacggcctg
gcgcgtttcgacggcaccgccctgtacgaatacgacaaccctctggagggctaccaccag
gactggaacacgctgatctacaaccttggccgcaacgaagtgcgcggcttcatgatggcc
tcggcgctgcactggctgaagcacttccacatcgatggcctgcgtgtcgatgcagtggcc
tcgatgctgtaccgcgactattcgcgcaaggccggcgaatgggtgcccaaccgccacggc
gggcgcgagaacctggaagccatcgacttcatccgccacctaaacggcgtggcggcccat
gaggccccgggcgcgctgatcatcgccgaggagtccaccgcctggcccggcgtcagccag
ccgacccagcagggtggcctgggctttgcctacaagtggaacatgggctggatgcacgac
accttgcattacatccagaacgacccggtgcaccgcacttatcatcacaacgagatgagc
ttcgggctgatctatgcctattccgagcacttcatcctgcccatctcccacgacgaagtg
gtgcacggcaagcattcgctgatcgacaagatgcccggcgaccgctggcagaagttcgcc
aacctgcgtgcctacctcaccttcatgtgggcgcatccgggaaagaagctgctgttcatg
ggctgcgagttcggccagtggcgtgagtgggaccacgatggcgagctggactggtacctg
ctgcagtaccctgagcaccagggtgtacagcgcctggtcggcgacctcaaccgcctgtac
cgcgaggtgccggcgttgcacgagcaggattgccagccgcaggggttccagtggctgatt
ggtgacgatgcgcagaacagcgtgtatgcctggttgcgctggagcagcagtggcgagccg
gtgctggtggtggccaacttcaccccggtgccgcgcgaggggtatcgcattggcgtgccg
ttcggcgagcgctggcaggagctgttgaatagtgatgcagagctgtatgccgggtccaat
gtcggcaatttgggggtggtggagagtgaccagatagccagccatgggcagccgcagtcg
ctggccctgaacctgccgccgctgggtgttctgataatgaaaccagcctga

DBGET integrated database retrieval system