KEGG   Pseudomonas putida S16: PPS_3512Help
Entry
PPS_3512          CDS       T01570                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ppt  Pseudomonas putida S16
Pathway
ppt00630  Glyoxylate and dicarboxylate metabolism
ppt01100  Metabolic pathways
ppt01110  Biosynthesis of secondary metabolites
ppt01120  Microbial metabolism in diverse environments
ppt01200  Carbon metabolism
Module
ppt_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PPS_3512
Enzymes [BR:ppt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PPS_3512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEJ14057
UniProt: F8G689
Position
3954385..3955710
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSLQPEHTLARLGAEKLWKLVT
EGAHPSFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNAFRRADQIQWKAGKNPGDDGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVIGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADANKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgagaacccg
cgctggaaaggcgtgacccgtacctacaccgccgctgatgtcgttcgcctgcgtggctcc
ctgcagccggagcacaccctggcccgcctgggtgcagaaaaactgtggaagctggtcacc
gaaggtgcccacccgtccttccgcccagaaaaagatttcgtcaactgcatgggcgccctg
accggcggccaggcagtgcagcaggtcaaggccggcatccaggccatctacctgtccggc
tggcaggttgccgccgacaacaactcggccgagtccatgtaccctgaccagtcgctgtac
ccggtcgactcggtaccgaccgtggtcaagcgcatcaacaacgccttccgccgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgatggctacatcgactacttcgca
ccgatcgtggccgacgccgaagccggtttcggtggcgtactgaacgcctacgagctgatg
aagaacatgatcgaagcaggcgccgcaggtgtgcacttcgaagaccagctggcctcggtg
aaaaaatgcggccacatgggtggcaaggtactggtaccgacccaggaagccgtgcaaaag
ctggtggccgcgcgcctggcagctgacgtatcgggcgtgccgaccatcatcctggcccgt
accgacgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtgattggcgagcgcacccgtgaaggcttctacaaggtacgcgccggcctcgaccaggcc
atcgcccgcggcctggcctacgcgccgtacgccgacctgatctggtgcgaaaccgccaag
ccggacctggacgaagcccgccgcttcgccgaagcgatcaagaaggagtatccggaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaagaacctggacgacgcgacc
atcgccaagttccagcgcgagctgtcggcaatgggctacaagcaccagttcatcaccctg
gccggcatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgctgacgccaacaaaggctac
accttcgtggcgcaccagcaagaagtgggcactggctacttcgacgacatgaccaccgta
attcagggtggcgcatcgtcggtgactgcactgaccggttcgaccgaggaagagcagttc
cactga

DBGET integrated database retrieval system