KEGG   Pseudomonas putida S16: PPS_3512Help
Entry
PPS_3512          CDS       T01570                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ppt  Pseudomonas putida S16
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ppt01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ppt00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3954385..3955710
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKGVTRTYTAADVVRLRGSLQPEHTLARLGAEKLWKLVT
EGAHPSFRPEKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNAFRRADQIQWKAGKNPGDDGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVPTIILAR
TDANAADLLTSDCDPYDQPFVIGERTREGFYKVRAGLDQAIARGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQILSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWHGMFNLAHDYARNDMTAYVKLQEQEFADANKGYTFVAHQQEVGTGYFDDMTTV
IQGGASSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacagcaaattgcagccctcgagaaagactgggccgagaacccg
cgctggaaaggcgtgacccgtacctacaccgccgctgatgtcgttcgcctgcgtggctcc
ctgcagccggagcacaccctggcccgcctgggtgcagaaaaactgtggaagctggtcacc
gaaggtgcccacccgtccttccgcccagaaaaagatttcgtcaactgcatgggcgccctg
accggcggccaggcagtgcagcaggtcaaggccggcatccaggccatctacctgtccggc
tggcaggttgccgccgacaacaactcggccgagtccatgtaccctgaccagtcgctgtac
ccggtcgactcggtaccgaccgtggtcaagcgcatcaacaacgccttccgccgcgccgac
cagatccagtggaaagccggcaagaacccgggcgacgatggctacatcgactacttcgca
ccgatcgtggccgacgccgaagccggtttcggtggcgtactgaacgcctacgagctgatg
aagaacatgatcgaagcaggcgccgcaggtgtgcacttcgaagaccagctggcctcggtg
aaaaaatgcggccacatgggtggcaaggtactggtaccgacccaggaagccgtgcaaaag
ctggtggccgcgcgcctggcagctgacgtatcgggcgtgccgaccatcatcctggcccgt
accgacgccaacgccgccgacctgctgaccagcgactgcgacccgtacgaccagccgttc
gtgattggcgagcgcacccgtgaaggcttctacaaggtacgcgccggcctcgaccaggcc
atcgcccgcggcctggcctacgcgccgtacgccgacctgatctggtgcgaaaccgccaag
ccggacctggacgaagcccgccgcttcgccgaagcgatcaagaaggagtatccggaccag
atcctgtcgtacaactgctcgccttccttcaactggaagaagaacctggacgacgcgacc
atcgccaagttccagcgcgagctgtcggcaatgggctacaagcaccagttcatcaccctg
gccggcatccacaacatgtggcacggcatgttcaacctggcgcacgactacgcccgcaac
gacatgaccgcctacgtgaagctgcaggagcaggaattcgctgacgccaacaaaggctac
accttcgtggcgcaccagcaagaagtgggcactggctacttcgacgacatgaccaccgta
attcagggtggcgcatcgtcggtgactgcactgaccggttcgaccgaggaagagcagttc
cactga

DBGET integrated database retrieval system