KEGG   Pseudomonas putida S16: PPS_3593Help
Entry
PPS_3593          CDS       T01570                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ppt  Pseudomonas putida S16
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPS_3593
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPS_3593
   00650 Butanoate metabolism
    PPS_3593
  Energy metabolism
   00190 Oxidative phosphorylation
    PPS_3593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4048126..4048446)
Genome map
AA seq 106 aa AA seqDB search
MAQRVSAVVLAAYFLFLIGYVVAHPGIDYTQWHGLFSNNAMRIFSLLALVALGAHAWVGM
WTIATDYLTPMSFGKSATAIRFLFQAVCGVAMFAYFVWGVQILWGI
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcgcgtttctgcggtcgttctcgcggcttacttcctcttcctgatcggctac
gtggtcgcccacccaggcatcgactacacccagtggcatggtctgttctccaacaacgcg
atgcggatcttcagtctgctggccctcgttgccctgggcgctcacgcctgggtcggcatg
tggaccattgcgaccgactacctgacgcctatgtcgttcggcaagtcggcaactgcgatt
cgtttcctgttccaggcggtatgcggcgttgcgatgttcgcttacttcgtctggggtgtg
cagattctctggggtatctga

DBGET integrated database retrieval system