KEGG   Pseudomonas putida S16: PPS_3747Help
Entry
PPS_3747          CDS       T01570                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppt  Pseudomonas putida S16
Pathway
Two-component system
Bacterial chemotaxis
Module
CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PPS_3747
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PPS_3747
Enzymes [BR:ppt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PPS_3747
Two-component system [BR:ppt02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   PPS_3747
Bacterial motility proteins [BR:ppt02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PPS_3747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4230600..4231739)
Genome map
AA seq 379 aa AA seqDB search
MAVKVLVVDDSGFFRRRVSEILSADPTIQVVGTATNGKEAIDQALALKPDVITMDYEMPM
MDGITAVRHIMQRCPTPVLMFSSLTHEGARVTLDALDAGAVDYLPKNFEDISRNPDKVKQ
LLCEKVHTISRSNRRFGSYASHAPVAAPVPAPAGSGHAAASSFASPAAARTPAPARAAAP
AAAPAHSPAPKRKPYKLVAIGTSTGGPVALQRVLTQLPANFPAPIVLIQHMPAAFTKAFA
ERLDKLCRISVKEAEDGDMLRPGLALLAPGGKQMMIDGRGAVKILPGDERLNYKPCVDIT
FGSAAKSYGDKVLSVVLTGMGADGREGARLLKQGGSTVWAQDEASCVIYGMPMAIVKANL
ADAVYSLDEIGKHLVEACV
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaggtcctggtggtggatgattccggtttcttccgccgccgcgtctcggaa
atcctctcggcggatccgacgatccaggtagtgggtaccgcgaccaacggcaaggaagca
atcgaccaggcgctggcgctgaagcccgatgtcatcaccatggactacgaaatgcccatg
atggacggcatcaccgcggtgcggcacatcatgcagcgctgcccgacgccggtgttgatg
ttctcgtcgctgacccatgaaggcgcccgtgtcaccctcgatgcgctggatgccggtgcg
gtggattacctgccgaagaacttcgaggacatctcgcgcaaccccgacaaggtcaagcaa
ctgctgtgcgagaaggtgcataccatttcccgcagcaaccgccgttttggcagctacgcc
agccatgcgccggttgccgcacccgtacccgcgccagcaggcagcggtcacgcagctgcc
agcagtttcgccagcccggcagcggcgcgcacgcctgcgcctgcccgtgcagcggccccg
gcagcggcgccagcgcattcgccggcacccaagcgcaagccatacaaactggtggccatc
ggtacctccacgggcggcccggtcgccctgcagcgggtgctgacccagctgccggccaac
ttcccggcgccgatcgtactgatccagcacatgccggcggcgttcaccaaggcctttgcc
gagcgcctggacaagctgtgccgcatcagcgtcaaggaagccgaggacggcgacatgctg
cgcccgggcctggccctgctggccccaggtggcaagcagatgatgatcgacggccgtggc
gcggtgaaaatcctgcccggtgacgagcgtctgaactacaaaccgtgcgtggacatcacc
ttcggctcggcggccaagtcgtatggcgacaaggtgctgtcggtggtgcttaccggcatg
ggtgccgatggtcgtgaaggggcgcgcctgctcaagcagggcggcagcacggtctgggcc
caggatgaagccagctgcgtgatctatggcatgcccatggccatcgtcaaggccaacctg
gccgacgcggtgtacagcctggacgaaatcggcaagcacctggtggaggcgtgcgtctga

DBGET integrated database retrieval system