KEGG   Pseudomonas putida S16: PPS_4001Help
Entry
PPS_4001          CDS       T01570                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ppt  Pseudomonas putida S16
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PPS_4001
Enzymes [BR:ppt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PPS_4001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4520448..4521053)
Genome map
AA seq 201 aa AA seqDB search
MRGTLAEKQPPHLIIDVNGVGYELEVPMTTLYRLPKVGEPVTVHTHLVVREDAHLLYGFA
EKRERELFRELIRLNGVGPKLALALMSGLEVDELVRCVQAQDTSALVRVPGVGKKTAERL
LVELKDRFKAWETSPAMFTLVSDGPLPVASASTAEADAVSALVSLGYKPQEASKAIAAIK
DKAGLSSEELIRRSLKGMITK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcggcaccctggcggaaaaacagccgccgcacctgattatcgacgtcaacggcgta
ggttacgaactggaagttcccatgaccacgctgtaccgtctgcccaaggtgggcgaaccc
gtaaccgtgcacacccacctggtggtgcgcgaggatgctcacctgctctacggttttgcc
gaaaagcgtgagcgcgagctgttccgcgaactcatccgtttgaatggggtagggccgaag
ctggccctggcgctgatgtccgggctggaagtggacgagctggtgcgctgcgtgcaggct
caggacacctcggccctggtgcgcgtgcccggtgttggcaagaaaaccgccgaacgcctg
ctggtcgagctcaaggaccgtttcaaggcttgggaaacgtccccggccatgttcaccctg
gtctccgacgggccgctgccggtcgccagcgcatccacggccgaagccgatgccgtcagc
gccctggtttccctgggctacaagccgcaggaagccagcaaggcgattgccgcgatcaag
gacaaggccggcctgagcagtgaggagctgatccgccgcagcctgaaagggatgattacc
aagtga

DBGET integrated database retrieval system