KEGG   Pseudomonas putida S16: PPS_4036Help
Entry
PPS_4036          CDS       T01570                                 

Definition
ribonucleotide-diphosphate reductase subunit beta
Orthology
K00526  
ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
ppt  Pseudomonas putida S16
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ppt00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppt00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4561428..4562705
Genome map
AA seq 425 aa AA seqDB search
MALKQENLTMLSWDEFDKEDGEVAAKGNTPAQAAAAATLDKLDSAGGAAALEARAATADD
SDAVKRAKAALNDLDIAEGLAELEGSGARVRVDEKRMINCRADLNQLVPFKYDWAWQKYL
DGCANHWMPQEVNMTADIALWKSMDGLTEDERRIVMRNLGFFSTADSLVANNLALAVYRL
ITNPECRQYILRQAFEEAIHTHAYQYCIESLGMDEGEIFNMYHEIPSVAKKAAWGLKYTR
AISDPEFNTGTVETDKELLRNLIAYYCVLEGIFFYCGFTQILSMGRRNKMTGVAEQFQYI
LRDESMHLNFGIDVINQIKIENPHLWDAAMKEEATQMILQGTQLEIEYARDTMPRGVLGM
NAAMMEDYLKFIANRRLTQIGLKEEYPGTTNPFPWMSEIMDLKKEKNFFETRVIEYQTGG
ALSWD
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggccctcaagcaggagaatctcaccatgctgagttgggacgaattcgataaagaagac
ggcgaagtagccgccaaaggcaacacccctgcgcaggccgctgctgccgccaccctcgac
aagctcgacagcgccggtggtgccgccgccctggaagcccgtgccgccaccgccgacgac
tccgacgccgtcaagcgcgccaaggctgccctgaacgacctcgacatcgccgaaggcctg
gccgagctggaaggctccggcgcccgcgtgcgtgttgacgaaaagcgcatgatcaactgc
cgcgccgacctcaaccagctggtaccgttcaagtacgattgggcctggcagaagtacctg
gacggctgcgccaaccactggatgccgcaagaggtcaacatgaccgccgacatcgccctg
tggaagagcatggacggcctgaccgaagacgagcgtcgcatcgtcatgcgcaacctcggc
ttcttctccactgccgactcgctggtagccaacaacctggccctggccgtgtaccgcctg
atcaccaacccggagtgccgccagtacatcctgcgccaggccttcgaagaggcgatccac
acccacgcctaccagtactgcatcgagtcgctgggcatggatgaaggcgagatcttcaac
atgtaccacgagatcccgtcggtagcgaagaaagccgcctggggcctgaagtacacccgc
gccatctccgatccggaattcaacaccggcaccgtcgaaaccgacaaagagctgctgcgc
aacctgatcgcctactactgcgtactggaaggcatcttcttctactgcggcttcacccag
atcctgtccatgggccgccgcaacaagatgaccggcgtggccgagcagttccagtacatc
ctgcgtgacgagtcgatgcacctgaacttcggtatcgacgtgatcaaccagatcaagatc
gagaacccgcacctgtgggacgcggcgatgaaggaagaagcgacccagatgatcctgcaa
gggacccagctggagatcgaatacgcccgtgacaccatgccacgcggcgtgctgggcatg
aacgcagcgatgatggaagactacctcaagttcatcgccaaccgtcgcctgacccagatt
ggtctgaaggaagagtacccagggactaccaacccgttcccgtggatgagcgagatcatg
gacttgaagaaagagaagaacttcttcgagacccgtgtgatcgagtatcagactggtggg
gcgttgagctgggattga

DBGET integrated database retrieval system