KEGG   Pseudomonas putida S16: PPS_4180Help
Entry
PPS_4180          CDS       T01570                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppt  Pseudomonas putida S16
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ppt00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4730160..4731659
Genome map
AA seq 499 aa AA seqDB search
MTDTQDKNYIIALDQGTTSSRAIIFDRDANVVGTSQREFAQHYPQAGWVEHDPMEIFATQ
SATMVEALAQAGISHAQVAALGITNQRETTVVWDKETGRPVYNAIVWQCRRSTEICAQLK
RDGHEGYIRETTGLVTDPYFSGTKLKWILDNVEGARERAERGELLFGTIDTWLIWKFSGG
KVHVTDYTNASRTLMFNIHSLQWDDKLLEILGIPRQMLPEVRPSSEVYGHTKSGIAIAGI
AGDQQSALFGQMCVEPGQAKNTYGTGCFLLMNTGDQAVKSSHGLLTTIACGPRGEVAYAL
EGAVFNGGSTVQWLRDELKIVNDALDTEYFASKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVKVDHIIRAALESIAYQTRDVLDAMQQDCGQRLSELRVDGGAVANNFLMQFQ
ADILGTCVERPKMRETTALGAAYLAGLACGFWSGLDELRDKAIIEREFSPQLDETQKEKL
YAGWKKAVDRTRDWEDHEA
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacagacacccaggataagaactacatcatcgccctggaccagggcaccaccagttcg
cgggccattattttcgaccgcgacgccaatgtggtggggacctcccagcgcgagttcgcc
cagcactacccgcaggcgggctgggtcgagcacgacccgatggaaatctttgccacgcag
agcgcgaccatggtcgaggccttggcccaggcgggcatcagccacgcccaggtcgccgca
ctgggtatcaccaaccaacgtgaaaccaccgtggtgtgggacaaggaaaccggccgcccg
gtgtacaacgccatcgtctggcagtgccgccgcagcactgagatctgcgcccagctcaag
cgcgacggccatgaaggctacatccgcgaaaccaccggcctggtcaccgacccatacttc
tccggcaccaaactgaagtggatcctcgacaatgtcgagggtgcccgcgaacgcgccgag
cgcggcgagctgctgttcggcaccatcgatacctggctgatctggaagttctccggcggc
aaggtgcatgtcactgattacaccaacgcctcgcgcacgctgatgttcaacatccacagc
ctgcagtgggacgacaagctcctggaaatcctcggcatcccacggcagatgctgcccgag
gtacgcccttcctccgaggtctacggccataccaagagcggtatcgccattgccggtatc
gccggtgatcagcaatcggcactgttcggccagatgtgcgttgaaccgggccaggccaag
aacacctatggcaccggctgcttcctgctgatgaacaccggtgaccaggcggtgaagtcg
tcccatggcctgctaaccaccatcgcctgcggcccgcgtggtgaagtggcctatgcgctg
gagggcgcagtgttcaatggtggttccaccgtgcagtggctgcgtgacgaactgaagatc
gtcaacgacgcactggataccgaatacttcgccagcaaggtcaaggacagcaacggcgta
tacctggtgcctgccttcaccggcctgggtgccccgtactgggacccgtatgcccgtggc
gcactgttcggcctgacccgtggcgtgaaggtggaccacatcatccgcgccgcgctggaa
tccatcgcctaccagactcgcgacgtgctcgacgccatgcagcaggattgcggccagcgc
ctgtccgagctgcgcgtggacggcggtgcggttgccaacaacttcctcatgcagttccag
gccgacatcctcggcacctgcgtagagcggccgaagatgcgcgaaaccacggcgctgggg
gcggcctacctggcagggctggcctgtggcttctggagcggcctggacgaactgcgcgac
aaggcgatcatcgagcgcgagttcagcccgcagctggatgaaacgcagaaagagaagctg
tacgcaggctggaagaaggcagtcgatcgtacccgtgactgggaagatcacgaggcctga

DBGET integrated database retrieval system