KEGG   Pseudomonas putida S16: PPS_4459Help
Entry
PPS_4459          CDS       T01570                                 

Definition
short-chain dehydrogenase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
ppt  Pseudomonas putida S16
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPS_4459
   00670 One carbon pool by folate
    PPS_4459
Enzymes [BR:ppt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PPS_4459
    1.5.1.-  
     PPS_4459
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5041926..5042663
Genome map
AA seq 245 aa AA seqDB search
MLGGNQRTDKLTAPNMNSPILVTGASQRVGLALALELAQAGHTVVSASRSIQPQAAHPNI
VQFQADLCQLADRQALIDYLHNHYDGLRAVIHNASLWLDDGLDNLETMFRLHVEAPYHLN
LALGDLLAKVEKADIIHICDETSSRGSKSHIGYAATKAALQNMVLSFAEKYAPKVRVNGI
LPGLLILKEGGDETYRQQTLKKALLEFEPGAGPLIETVKYLLASQYSTGSQVVINGGRHL
KNRMT
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcggcaaccaaaggacagacaagttgaccgccccgaacatgaacagccccatt
ctcgttaccggagccagccagcgcgtcgggctggccctggcccttgaactggcacaggcc
ggccatacggtggtcagtgccagccgcagcatccagccacaggcggcccacccgaacatc
gtgcagttccaggccgacctgtgccagctggccgatcgacaggccctgatcgactacttg
cacaaccattacgacggcctgcgcgcggtcatccacaacgcctcgttgtggctcgacgat
ggcctcgacaacctcgagaccatgttccgccttcacgtcgaagcgccctaccacctcaac
ctggccttgggcgacctgctggccaaggtggaaaaggccgacatcatccacatttgcgac
gaaacctcttcgcgcggcagcaaaagccacatcggctacgccgcgaccaaggccgcgttg
cagaacatggtgctgtcgttcgccgaaaaatatgcgcccaaggtgcgtgtgaacggtatc
ctgcccgggctgctgatcctcaaggaagggggtgacgaaacctaccgccagcagaccctg
aaaaaggccctgctggagttcgaacccggcgccggcccgctgatcgagacggtaaagtac
ctgctcgccagccagtacagcaccggcagccaggtggtcatcaacggtggccgccacctg
aagaaccgcatgacctga

DBGET integrated database retrieval system